KEGG   Deinococcus wulumuqiensis: DVJ83_03165Help
Entry
DVJ83_03165       CDS       T05579                                 

Definition
(GenBank) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
dwu  Deinococcus wulumuqiensis
Pathway
dwu00564  Glycerophospholipid metabolism
dwu01100  Metabolic pathways
dwu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dwu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DVJ83_03165
Enzymes [BR:dwu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     DVJ83_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AXG98329
UniProt: A0A345IF57
Position
complement(621695..622402)
Genome map
AA seq 235 aa AA seqDB search
MPSAIRLPPSAYPSPMRLPRRFPLLAAFAAGVWYLRSVYRFRDPVRLPATQDGGAILSPA
DGLVSFVRRIEGGRADGLSVAELLGTPQQEGWLLGIFTGPLDVHFTYAPAEGTVLSAGRK
PGERAAVPVSDAAQLLAGRAVNLLGSAAVRGNERYSYAVQGEGGQVVTVGLITPGAGLNA
TTYLDEGQTVRQGNKAAFLAEGGLVLLALPQSVTPQVSVGERVRGAETVVAGQAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgccatctgccatccgcctcccgccctccgcgtatccttcccccatgcgtcttccccgc
cgttttcccctgttggccgcctttgccgctggcgtctggtatctccgcagcgtctaccgc
ttccgcgacccggtgcgccttccggccacccaggacgggggggccatcctctcgcctgcc
gacgggctggtgtcgttcgtgcgccgtatcgaggggggccgggcagacgggctgagcgtg
gccgaactgctcggcacgccccagcaggagggctggctgctgggcattttcacggggccg
ctggacgtgcatttcacctatgccccggctgagggcaccgtactcagcgcaggtcgcaag
ccgggagagcgggccgccgtgcccgtgagcgacgccgcccagcttctggcgggccgggcg
gtgaacctgctcggcagcgccgccgtgcgcggcaacgagcgctacagctacgccgtgcag
ggcgaaggcgggcaggtcgtgacggtgggcctgatcacccccggcgcgggcctgaacgcc
accacctatctggacgagggccagaccgtgcgccagggcaacaaggccgcgtttctggcc
gaaggtgggctggtgctgctcgccctgccgcagagcgtgaccccccaggtcagcgtgggc
gagcgcgtgcgcggggcggagacggtggtggcggggcaggccgtctag

DBGET integrated database retrieval system