KEGG   Deinococcus wulumuqiensis: DVJ83_11740Help
Entry
DVJ83_11740       CDS       T05579                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
dwu  Deinococcus wulumuqiensis
Brite
KEGG Orthology (KO) [BR:dwu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DVJ83_11740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AXG99687
UniProt: A0A345IJ15
Position
2339323..2339709
Genome map
AA seq 128 aa AA seqDB search
MSSFPDISVTVQVQHVPSHSTPQRQLFAYFITIDNHSDESWKLLSRHWDITSGDGQQFTV
EGEGVVGEQPLLTPGAQYTYNSFVTVDALPGRMEGHYVMQNAWGEQTRVPIAPFRLDVLP
ESGERLLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttttcccgacatcagcgtgaccgtgcaggtgcagcacgttccctcccacagc
acgccgcagcgccaactgttcgcctacttcatcaccatcgacaaccacagcgacgaaagc
tggaagctgctcagccgccactgggacatcaccagcggcgacggccagcagttcacggtg
gagggtgagggcgtggtgggcgagcagccgctgctcacgccgggcgcccagtacacctac
aactcgttcgtcacggtggacgccctgccgggccgcatggagggccactacgtgatgcaa
aacgcctggggcgagcagacgcgggtgccgattgcgccgttccggctggacgtgctgccc
gagtcgggcgagcggctgctgaactga

DBGET integrated database retrieval system