KEGG   Deinococcus wulumuqiensis: DVJ83_12725Help
Entry
DVJ83_12725       CDS       T05579                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dwu  Deinococcus wulumuqiensis
Pathway
dwu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dwu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DVJ83_12725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dwu03011]
    DVJ83_12725
Ribosome [BR:dwu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DVJ83_12725
  Bacteria
    DVJ83_12725
  Archaea
    DVJ83_12725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AXG99844
UniProt: A0A345IJH2
Position
2535076..2535480
Genome map
AA seq 134 aa AA seqDB search
MTAPEQTFRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFI
PRSASEPVAKVLNSAKANAVHNDEMLEDRLFVKEAYVDAGPTLKRLIPRARGSANIIKKR
TSHITIIVAEKGAK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcctgaacagactttccgcaacaagaagcagcgcaagcagcaggtcaagctg
cgcaagcccggcttcgccgttgccaagtacgtccgcatgagcccccgcaaggtgcgcctg
gtcgtggacgtgattcgtggcaagagcgttcaggacgccgaagacctgctgcgcttcatc
ccccgctcggccagtgaacccgtcgccaaggtgctcaacagcgccaaggccaacgccgtg
cacaacgacgagatgctcgaagaccgtctcttcgtcaaggaagcctacgtggacgccgga
ccgacgctcaagcgcctgattccccgcgcccgtggctcggccaacatcatcaagaagcgc
accagccacatcaccatcatcgttgccgagaagggagccaaataa

DBGET integrated database retrieval system