KEGG   Deinococcus wulumuqiensis: DVJ83_13515Help
Entry
DVJ83_13515       CDS       T05579                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
dwu  Deinococcus wulumuqiensis
Pathway
dwu00053  Ascorbate and aldarate metabolism
dwu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    DVJ83_13515
Enzymes [BR:dwu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     DVJ83_13515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: AXH00219
UniProt: A0A345IKJ6
Position
pDrdA:complement(27773..28585)
Genome map
AA seq 270 aa AA seqDB search
MTQRLLITGAAGEVGSALRSLLREHLQGQFPILRLTDNRDLGEAQPGEELTPADLTDFDA
VLNVMQDVDAVIHLGGIADEDTYQNIRAVNMDGTYNVLEAARRSGVGRVAFASSIHTVGF
YPRSETISPTVPVRPDTYYGVSKVFGEALGRMYWERYGIEFVGVRICSFQPRPKDRRHLS
TWLSPRDAAQLFARAVTAPDVGFLVVAGISGNTRRWMSPEGWDVLGYVPQDDAESFAAEV
EHLHGDESDITEQRQGGVFVDSGYVGRAGR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagcgcctcctcatcacgggcgcggcgggcgaagtcggttcggcgttgcgttcg
ctcttgcgggagcatctgcaagggcaatttcctatcctgcgtctgacggacaaccgcgac
ctgggcgaggcgcagcccggcgaggaactgacgcccgccgatctgaccgacttcgacgcc
gtactgaacgtcatgcaggacgtggacgcggtgattcacctgggcgggattgccgacgag
gacacctaccagaacattcgggccgtgaacatggatggcacctacaacgtgctggaagcg
gcgcggcgttcaggcgtggggcgggtggcgttcgcgtccagcattcacaccgtcggcttt
tacccgcgcagcgagaccatctcccctaccgtgcctgtgcgcccggacacctactacggc
gtgagcaaggtgtttggcgaggcgctgggtcggatgtactgggaacggtacggcatcgag
ttcgtgggcgtgcgcatctgctcgttccagccgcgcccgaaagaccgccgccacctctcc
acctggctttccccgcgtgacgccgcgcagctgttcgcccgcgctgtgaccgcgccggac
gtgggttttctggtcgtggcgggtatcagtggcaacacccgccgctggatgtcgcccgaa
ggctgggacgtgctgggctacgtgccgcaggacgacgccgaaagctttgctgccgaggtg
gaacaccttcacggcgatgagtcggacatcaccgagcagcgccagggcggggtttttgtg
gattcggggtatgtggggagggcggggcggtga

DBGET integrated database retrieval system