KEGG   Deinococcus wulumuqiensis: DVJ83_18195Help
Entry
DVJ83_18195       CDS       T05579                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dwu  Deinococcus wulumuqiensis
Pathway
dwu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dwu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DVJ83_18195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dwu03400]
    DVJ83_18195
Enzymes [BR:dwu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DVJ83_18195
DNA repair and recombination proteins [BR:dwu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DVJ83_18195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD_C_2 SH3_13 Viral_helicase1 UvrD_C PIF1
Motif
Other DBs
NCBI-ProteinID: AXH01024
UniProt: A0A345IMV1
Position
pDrdI:complement(536415..537107)
Genome map
AA seq 230 aa AA seqDB search
MPSPEKPRSLERGVVTKTHRQAEGSPILKLAHMLIGGEVPAHTGVPFEKAESAGDIVALA
QRVAQETGTSPMVLTAGRTGTLGVGNLNLALQEALNPGDTKFRLGDPVMMTRNDHDQGLM
NGMTGRIVSLGKKVVCDFEGKLYELPPGYVNFFDLAYAMTIHRSQGSEWGEVIVTLSEQH
GRLLSRQLAYTAVTRAKQGLVASGARNAWKRSALTGFPERYSRLERMLRE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgcctgagaagcctcgctctttagagcggggagtggtcacgaaaacccaccgt
caggcggaaggcagccccatcctgaaactcgcgcacatgctgatcgggggagaggtgcct
gctcacacgggcgtcccattcgagaaggctgaaagcgctggggacatcgtggccttggcc
cagcgcgtcgcgcaggaaacgggcacgtccccgatggtcctgactgcaggccgcactgga
accctgggtgtgggcaacttgaatctggccttgcaggaagcccttaatccaggtgacacc
aagttccgcctcggcgacccggtgatgatgacccgcaacgaccacgaccagggcctcatg
aacggcatgacggggagaatcgtcagtctgggcaagaaggtggtgtgtgatttcgagggc
aagctgtatgaattgccccctgggtacgtgaacttcttcgatctggcgtacgcgatgacc
attcaccgctctcagggaagtgaatggggggaagtgatcgtgacgctcagtgagcagcat
gggcgattgctgtcgcgtcagctggcttatacagcagtcacgcgggccaaacagggattg
gttgcgagcggggcgagaaatgcctggaagcgaagtgccttgacgggtttcccggagcgg
tactcgcggctcgaacggatgctgcgggagtga

DBGET integrated database retrieval system