KEGG   Drosophila yakuba: Dyak_GE10832
Entry
Dyak_GE10832      CDS       T01068                                 
Symbol
Dyak_Hsp68
Name
(GenBank) Hsp68
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dya  Drosophila yakuba
Pathway
dya03040  Spliceosome
dya04141  Protein processing in endoplasmic reticulum
dya04144  Endocytosis
dya04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dyak_GE10832 (Dyak_Hsp68)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dyak_GE10832 (Dyak_Hsp68)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dyak_GE10832 (Dyak_Hsp68)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dyak_GE10832 (Dyak_Hsp68)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dya01009]
    Dyak_GE10832 (Dyak_Hsp68)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dya03041]
    Dyak_GE10832 (Dyak_Hsp68)
   03009 Ribosome biogenesis [BR:dya03009]
    Dyak_GE10832 (Dyak_Hsp68)
   03110 Chaperones and folding catalysts [BR:dya03110]
    Dyak_GE10832 (Dyak_Hsp68)
   04131 Membrane trafficking [BR:dya04131]
    Dyak_GE10832 (Dyak_Hsp68)
   03051 Proteasome [BR:dya03051]
    Dyak_GE10832 (Dyak_Hsp68)
   03029 Mitochondrial biogenesis [BR:dya03029]
    Dyak_GE10832 (Dyak_Hsp68)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dya04147]
    Dyak_GE10832 (Dyak_Hsp68)
Protein phosphatases and associated proteins [BR:dya01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dyak_GE10832 (Dyak_Hsp68)
Spliceosome [BR:dya03041]
 Complex B
  Other components
   Prp19 complex
    Dyak_GE10832 (Dyak_Hsp68)
 Complex C
   Prp19-CDC5 complex
    Dyak_GE10832 (Dyak_Hsp68)
Ribosome biogenesis [BR:dya03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Dyak_GE10832 (Dyak_Hsp68)
Chaperones and folding catalysts [BR:dya03110]
 Heat shock proteins
  HSP70 / DNAK
   Dyak_GE10832 (Dyak_Hsp68)
Membrane trafficking [BR:dya04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Dyak_GE10832 (Dyak_Hsp68)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Dyak_GE10832 (Dyak_Hsp68)
Proteasome [BR:dya03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Dyak_GE10832 (Dyak_Hsp68)
Mitochondrial biogenesis [BR:dya03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Dyak_GE10832 (Dyak_Hsp68)
Exosome [BR:dya04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dyak_GE10832 (Dyak_Hsp68)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A StbA
Other DBs
NCBI-ProteinID: EDW99011
FlyBase: FBgn0042719
UniProt: B4PL26
Position
3R
AA seq 635 aa
MPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP
KNSVFDAKRLIGRRFDDSKIQEDMKHWPFKVINDNGKPKMSVEFKGAEKRFAPEEISSMV
LIKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHFA
EEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARF
EELCGDLFRNTLQPVEKALNDAKMDKSQIHDIVLVGGSTRIPKVQNLLQGFFGGKSLNLS
INPDEAVAYGAAIQAAILSGDNSSQIKDVLLVDVAPLSLGIETAGGVMTKLIERNCRIPC
KQSKTFTTFTDNQPAVTIQVFEGERALTKDNNVLGTFNLTGIPPAPRGVPKIDVTFDLDA
NGILNVTAMEQGTGNAKNITIKNDKGRLSQADIDRMLSEAEMYAEEDERHRQRIAARNQL
ESYVFSVKEAAENGGDRISATDKSSILERCSEAVKWLDSNTTAEKQEYEHKLKELTQFCS
PIMTKMHKGGGDGQQAPNCGQQAGGYKGPTVEEVD
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgccagccattggaatcgatttgggcaccacgtactcctgcgtgggtgtcttccagcac
ggaaaggtggagatcatcgccaacgaccagggtaaccgtaccaccccatcgtacgtggcc
ttcacggactcggaacgcctcattggagatgcggccaagaaccaggtggccatgaatccc
aaaaactcggtcttcgatgccaagcgtctgattggacgtcgtttcgacgattccaagatc
caggaggacatgaagcactggccgttcaaagtgatcaatgacaacggcaagccaaagatg
agcgttgagttcaagggcgcggagaagcgcttcgctcccgaggagattagctcgatggta
ctcatcaaaatgaaggaaaccgcagaagcctatctgggcactacagtgaaggacgccgtc
atcactgtgccggcctacttcaacgactcgcagcgccaggcaacaaaggatgctggcgcc
atcgctggcctcaatgtgctccgcatcatcaacgagcctacggcggcggcactggcctac
ggcctggacaagaatctgaagggagagcgcaatgtgcttattttcgatctgggcggtggt
acctttgacgtctccatcttgaccattgacgagggatctctgtttgaggtgcgctccacg
gccggagacacccatctaggtggcgaggactttgacaaccgattggttacccactttgcc
gaggagtttaagcgcaagtacaagaaggatttgcgctccaacccacgcgcactacgtcgc
cttcgcacggcagccgaacgcgctaagcgcaccctttcctccagcacggaggcttcgctg
gagattgacgccctgtatgagggacacgacttctactccaaggtgagccgcgccagattc
gaggaactgtgcggtgacctcttccgcaacacactgcagcccgttgagaaggcactcaat
gacgccaagatggacaagagtcagatccatgacatcgtgctggttggaggctcaacccgt
attccgaaggttcagaacctgctgcagggtttcttcggcggaaagagcctgaacttgtca
atcaatccggacgaggcggtagcatacggagcagccatccaggctgccattctgtcgggt
gacaacagcagccagatcaaggacgtcctactagtcgatgttgctccactctcgttgggt
atcgagaccgccggcggggtgatgaccaagctgatcgaacgcaactgccgcattccgtgc
aagcagtccaagaccttcaccacattcaccgacaaccagccggcggtgaccattcaagtg
tttgagggcgagagggctttgaccaaggacaacaatgtgttgggcaccttcaatctgact
ggcattccgcccgcacccagaggagtgcccaagatcgacgtcaccttcgatttggacgct
aacggtatcctgaatgtgaccgccatggagcagggcactggaaacgccaagaacataacc
atcaagaacgacaagggtcgcttgtcgcaggcggacattgatcgcatgcttagtgaggcg
gagatgtacgccgaagaggacgagcgccatcgccagcggatcgccgcccgcaatcaactg
gagagctatgtgtttagtgtaaaggaggcggccgagaatggtggcgatcgcatcagtgcc
accgacaagagcagcattctggagcgctgcagcgaggcggtgaaatggttggacagcaac
accaccgccgagaagcaggagtacgagcacaagctgaaggaactgacccagttctgcagc
cccatcatgaccaagatgcacaagggaggtggagacgggcagcaggctccaaattgtgga
cagcaggcgggcggttacaagggtcccactgtcgaggaggtggactaa

DBGET integrated database retrieval system