KEGG   Drosophila yakuba: Dyak_GE11808
Entry
Dyak_GE11808      CDS       T01068                                 
Name
(GenBank) uncharacterized protein, isoform A
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
dya  Drosophila yakuba
Pathway
dya04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    Dyak_GE11808
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dyak_GE11808
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     Dyak_GE11808
SSDB
Motif
Pfam: NAD_binding_4 Sterile 3Beta_HSD Epimerase Polysacc_synt_2 GDP_Man_Dehyd RmlD_sub_bind KH_dom-like KR Semialdhyde_dh
Other DBs
NCBI-ProteinID: EDW91895
FlyBase: FBgn0229599
UniProt: B4P5X9
Position
2R
AA seq 624 aa
MSHAVANKTETEAAPNSSLKQSAAPQPANSHDAKLLNGTLARTNGLTHAASVATSSSGYG
SSSAAGSNAGSGGATSSSSSSSAAAVASSTALPLPPSSNGLQMPYERFRADDTSYVPIAQ
FYAGRSVFITGGTGFMGKVLVEKLLRSCPDIRNIYLLIRPKRGQEVSARLTELLNAPLFE
SLRQEKPKELSKVIPISGDITSEELGISEKDQNLLCRNVSVVFHSAATVKFDEKLKLSVT
INMLGTKRLVELCHRMLSLDALIHVSTAYCNCDRTDVSEVIYAPPYNPDDIISLINWLPE
DILDQLTPRLIGKRPNTYTFTKALAEHMLLKEAGNLPVAIVRPSIVTASLNEPFAGWVDN
FNGPTGLVSALAKGMFRTMMCEKNYVADMVPVDIVINLMIAAAWRTATRKSNNLLIYNCC
TGQRNPIIWSEFVQHAMTSVRKHPLEGCLWYPTGDLRMNRPMNTLNCIAKHFLPAYILDG
VARIMGKKPFVVNVQNKIAKAVECLEYFATRQWRFKDDNVHALLHTLSPKDREIFVFDVR
HINWDKYVERYVLGFREFLFKQRPESLPASRKRMLRLYYLHQLTKVVAVLLTWRFLMSRS
KRLNDLWSSFLENALRMARLIPFL
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgtcacacgcggtagccaacaaaacggaaacggaagcagcgccaaacagcagcctcaaa
cagtccgcagccccccagcccgcaaacagtcacgatgccaagctgctcaacggcactttg
gcccgaaccaacggactaacccatgccgccagcgtggccacctcctcctccggctatggc
agttcgagcgcggccggatcgaacgcgggttccggcggagccacctcatcctcgtcctca
tcctcggcggcggcggtggcgtcctcgacggccctgcccttgccgcccagcagcaacggc
cttcagatgccctacgagcgcttccgggcggacgacaccagctatgtgcccatcgcccag
ttttacgcgggacgcagtgtcttcatcacaggcggaactggatttatgggaaaggttctg
gtggagaagttgctgcgctcatgtccggacataaggaatatatatctactgatacgaccg
aaacgcggtcaagaagtgtcagctcgactcacggaactactaaatgcaccactcttcgaa
tcactgcgtcaggagaagcccaaggaactcagcaaagtcatacccatatcgggcgacata
acttccgaggaactgggcatttcagaaaaggatcagaatctactgtgtcgcaatgtttcc
gttgtctttcactcggctgccactgtgaaattcgatgagaagctcaaactgtctgtcaca
atcaatatgctgggcacgaaacgcctcgtcgagctctgccatcgcatgctgtcactggac
gcactaatccatgtatccactgcctattgcaattgcgatagaaccgatgtgtccgaggtt
atctacgcaccgccctacaatcccgatgatatcatttcactaatcaactggcttccggag
gatatactcgatcagcttacaccgcgcctgattggcaagcgtcccaatacgtacacgttt
acaaaagccttagcggagcatatgttacttaaggaggctggtaatctgcccgttgccatc
gtgaggccatcgattgtgactgccagtctgaatgagccctttgccggttgggtggacaac
ttcaatgggccaacgggcctggtttcggcgctggccaagggcatgttccgcacgatgatg
tgcgagaagaactatgtggccgatatggtacctgtcgatattgtgattaacctgatgatt
gccgccgcctggcgcacagcgacccgcaagtcaaataacctactcatctacaattgttgc
accggccagcgcaatcccatcatctggtcggagtttgtccaacacgccatgacgagtgtg
cgcaagcatcccctggagggctgcctgtggtatccgactggcgacctgcgcatgaaccgc
cccatgaacacgctgaattgtatagccaagcactttttaccggcctacattctggacggt
gtggctagaatcatgggcaagaaaccattcgttgtcaacgtacaaaataaaattgccaaa
gctgtggaatgcctcgagtactttgccacacgccaatggcgcttcaaggacgacaacgtc
cacgccctgctgcacacgctgagtcccaaggatcgcgagatcttcgtcttcgacgtgcgc
cacatcaactgggataagtatgtggagcgctatgttttgggcttcagggagttcctgttc
aagcaacgacccgaatcgctgccggccagcagaaaacgcatgcttaggctctactatctg
catcagctgaccaaagtggtggcggtgctgctcacctggcgctttttgatgtcacgctcg
aagcgcctgaacgacttgtggagctccttcctggagaacgcgctcaggatggcacgcttg
ataccctttttgtaa

DBGET integrated database retrieval system