KEGG   Drosophila yakuba: Dyak_GE11882Help
Entry
Dyak_GE11882      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
dya  Drosophila yakuba
Pathway
dya03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dya00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Dyak_GE11882
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dya03012]
    Dyak_GE11882
Translation factors [BR:dya03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    Dyak_GE11882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI DUF2779
Motif
Other DBs
NCBI-GeneID: 6531239
NCBI-ProteinID: XP_002092051
FlyBase: FBpp0256892 FBgn0229666
UniProt: B4P562
Position
2R
AA seq 910 aa AA seqDB search
MSRFFANGSDSESESSEDEIQATNFNKASAFQFSDDEEEVKRVVRSTKEKRYENLTSIIK
TIRNHKKIKDIPNTLSSFEDLTRAYQKALPVISKEENGITPRFYIRCLAELEDFINEVWE
DREGRKNLSKNNSKSLGTLRQKVRKYIKDFEDDLSRFREAPDQESEAEDEVVAQESDGGD
AGDDSDAGVKPTEAAPKAVKSAPAKAAPADDDDSDDSIDWDSDSESETESSDDENQYQNM
RERFLKRTTEKEEKDDDKRKDKRKEQKVKIRKRAEDDEDGEWETVVKGHVVEKPKMFEKD
AEIDVPLVLAKLLEIMSARGKKRTDRRLQIDLLFELRDISDQHNLGTAVSVKIHFNIISA
IYDYNQKISEPMKLEHWALLLEVMQSMLKLLLANTDIIMSESVAEEHEEYVTAPFYVRGC
PLAAVERLDDEFVKLLKECDPHSNDYVSRLKDEVNVVKTIELVLQYFERSGTNNERCRIY
LRKIEHLYYKFDPEVLKKKRNEVPATTSTSVDVMDKLCKFIYAKDDTDRIRTRAILAHIY
HHAMHDNWFQARDLVLMSHLQDNIDAADPATRILYNRMMANLGLCAFRQENVKDAHHCLV
DLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLE
IPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACAN
FIVNKKMNTKVWDLFYESDRVREMLTKFIKEESLRTYLFTYSNVYTSISIPSLAQMYELP
VPKVHSIISKMIINEELMASLDDPSETVVMHRSEPSRLQALAMQFVDKVTNLVDVNEKVF
DMKQGNFFQRGNMGNRGDRGYNRNQNNQGGNWLGQRRDRNNRNRNQRGHHKNNQDRQQQQ
QQQVQTIDEE
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtttctttgccaacgggtccgactcggagtccgagtccagcgaggacgagatc
caagcgaccaacttcaacaaagccagcgccttccaattcagcgacgatgaggaagaggtc
aagcgcgtggtccgctccacgaaggagaagcgttacgagaacctaaccagcatcatcaaa
accattcgcaaccacaagaaaatcaaggatatccccaataccctgagcagcttcgaggat
ctgacgcgcgcctaccaaaaggcattgccggtcatctcaaaggaggagaacggcattacg
ccgcgattctacattcgctgcctggccgagttggaagacttcatcaacgaggtgtgggag
gatcgcgagggccggaagaatctttccaagaacaactccaagtcgctgggcacactgcgc
cagaaggtacgcaagtacattaaggacttcgaggatgacctgtcgcgtttccgtgaagca
cccgaccaggagagcgaggccgaggacgaggtggtagcccaggagagcgatggcggcgat
gctggtgatgacagcgacgccggagtgaagcccacagaagcggctccgaaagcggtgaag
tccgcgcctgcaaaggctgcgcccgccgatgacgacgattccgatgactccattgattgg
gactcggactctgaatcggagactgagtcctccgacgatgagaaccagtaccagaacatg
cgcgagcgtttcttgaagcgtactaccgaaaaggaggaaaaggacgacgacaagaggaag
gataagcgtaaggagcagaaggtcaagatccgcaagcgcgctgaagacgatgaggatggc
gagtgggagaccgtggtcaagggtcatgtggtagagaagcccaagatgttcgaaaaggac
gcagagatcgatgttcccctggtgctggccaagctgttggaaattatgtccgctcgcggc
aagaagcgcaccgatcgccgtctgcagatcgatcttctgttcgagctgagggacatctcc
gatcagcacaacctgggcaccgccgtctccgtgaagattcacttcaacatcatctcggct
atctacgattacaaccagaagatttccgagcccatgaagctagagcactgggctctgctt
ttggaggtgatgcagagcatgttgaagcttctactggccaacaccgacatcattatgagc
gagagcgtggccgaggagcacgaggaatacgtcacggcgccgttttacgtgaggggatgc
ccactggctgccgtggagcgcctggatgacgagtttgtcaagctgctgaaggaatgcgat
ccacactcgaacgactacgtgtcccgactaaaggacgaggtgaacgtggtgaagactatt
gaactggtgctgcagtatttcgagcgttctggcaccaacaacgagcgctgtcgtatctac
ctgcgcaagatcgaacatctctactacaagtttgatccggaggtgctgaagaagaagcgc
aatgaagtgccagccaccacctcgacctccgtagacgtaatggataagctgtgcaaattc
atctacgccaaggacgatacggatcgtatccgtacaagggccatcttagcgcacatctac
catcatgccatgcacgacaactggttccaggcccgtgatctagtgctgatgtctcacctg
caggacaacatcgacgccgcagatcccgctacccgcatcctgtataaccgcatgatggcc
aatctgggactgtgtgccttccgccaggagaacgtcaaggatgctcatcactgtctggtg
gacctaatggtcaccggcaaacccaaggaactgctggcccaaggattgctgcctcaacgc
cagcacgagcgatctgccgagcaggagaaaatcgagaagcaacgccagatgccattccat
atgcacatcaaccttgagttgctcgaatgcgtctacctggtgtctgctatgctgctcgaa
attccttacattgccgcccacgagttcgacgcccgccgccgcatgatcagtaagacgttc
taccagcagttgcgctcctcagagcgtcagtctctggtgggaccaccagagtcgatgcgt
gagcacgtcgtggctgccgccaaggcgatgcgttgcggtaactggcaggcgtgcgccaac
tttatcgttaacaagaagatgaacacgaaggtttgggacctcttctacgagtctgatcgc
gtacgcgagatgctgaccaagttcatcaaggaggagtcgctgcgaacctacctgttcacc
tactcgaacgtctacacctcgatcagcattccctcgctggcgcagatgtacgagctgccc
gtgccgaaagtgcactccatcatcagtaagatgatcatcaacgaggaactcatggccagc
ctggacgacccatccgaaacagttgttatgcaccgctcggagccatcgcgtctgcaggcc
ctggccatgcagttcgtggacaaggtcacaaatctggtggacgtcaacgagaaggtgttc
gacatgaagcagggcaacttcttccagcgcggcaacatgggcaatcgcggagaccgtggc
tacaaccgcaaccagaacaaccagggcggcaattggcttggccagcggcgggatcgcaac
aaccgcaaccgtaaccagcgcgggcaccacaagaacaaccaagataggcagcagcagcaa
cagcaacaagtccaaaccatcgacgaggagtag

DBGET integrated database retrieval system