KEGG   Drosophila yakuba: Dyak_GE12162
Entry
Dyak_GE12162      CDS       T01068                                 

Name
(GenBank) uncharacterized protein
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
dya  Drosophila yakuba
Pathway
dya00520  Amino sugar and nucleotide sugar metabolism
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dyak_GE12162
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     Dyak_GE12162
SSDB
Motif
Pfam: Glyco_hydro_18 CBM_14
Other DBs
NCBI-ProteinID: EDW91309
FlyBase: FBgn0229928
UniProt: B4P9I9
Position
2R
AA seq 476 aa
MRSASGLVKLLLGAILMAAASSAQGNSSKNVVCYQGTWSVYRPGQGKFGVEDIDPFLCTH
LIYAFLGIEETGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNEGSKR
FSLVARDPLKRAKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLENDDRSNYITFLKELKE
GLEPFGFLLSAAVGSAQFSAEISYDIPAIVPYLDLINVMAYDLHGPWDKVVGINAPLYAA
ESDASDSTGRQQQLNVDAVVKYWLLAGAPAEKLILGVPFYGRSFTLANAEDNQPGAPHIG
KGIAGNFSREPGVLGYNELCEMMKLEEWTQKWEATQQVPYAYRQRQWVGYEDPRSLALKA
QYVMDHHLGGIMVWSLESDDFRGTCGQQPFPLLHEINRVLFGGNTPSGLTTESNKETTSK
GFSCPADALEGYVRDPDNCSKFYYCSGGKTHNFDCPIGLNFDLNTNRCDYSGSVKC
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgcggagcgcatctggtttagttaagctgctcctcggggcaatcctgatggcagcagct
tcatctgcacaaggcaactcttcaaaaaacgttgtgtgctaccagggcacgtggtccgtt
tatcgacctggtcagggcaagttcggcgtggaagatattgatccgtttttgtgcacccat
cttatttacgccttcctgggcatcgaggagactggccagcttcgagtgattgacgcttat
ctggatcttgaggagaatagtggacgcggaaatatcaagagctttaatgccctcaagcta
aagaatcctgtgttgaaaacgctcgtggccgtgggtggttggaacgagggttccaagaga
ttctccttagtggcacgtgatcccttgaagcgggccaagttcgtggatgatgtggtcagg
tttttgcagcgccacggattcgatggcctggatctggattgggagtatcctggccagcgt
cacagtctggaaaacgacgatcgctcgaactacattacctttttaaaggagctgaaggag
ggcttggaaccatttggtttcctgctcagtgctgctgtgggttccgcacaattctccgct
gaaatatcgtacgacattccggctattgtcccgtatctggacctcattaatgtgatggca
tacgaccttcacggaccgtgggacaaggtggtgggcatcaatgctcccctgtatgctgct
gaaagtgatgcaagtgattctaccggccgacaacagcagctgaacgtggacgccgtggtc
aagtattggctgctagcaggtgctcctgctgaaaagctaatcctaggagttcctttctac
ggccgctccttcacgttagccaatgccgaggacaatcaaccaggagcgccgcatatcggc
aagggtattgcaggaaacttctcccgcgaaccgggcgtcctgggttacaacgagctctgt
gagatgatgaagctggaggagtggacacagaaatgggaggccacacagcaggtgccttac
gcttacaggcagcgccagtgggtgggttacgaagatccacgtagcttggcactaaaggcg
cagtacgtgatggaccaccatctgggtggcataatggtctggtccctggaatcggatgac
ttccgcggcacttgcggtcagcagccctttcccctgctgcacgaaatcaaccgtgtgctc
ttcggcggcaacaccccatctggtttgaccaccgaatcgaacaaggaaacgaccagtaaa
ggattcagttgtccagctgatgcgctcgaaggatacgttcgtgatccggacaactgctcc
aagttctactattgcagtggcggcaaaacccacaactttgattgtcccattgggctgaac
tttgaccttaacaccaacaggtgcgactactctggatcagtaaagtgctag

DBGET integrated database retrieval system