KEGG   Drosophila yakuba: Dyak_GE12208Help
Entry
Dyak_GE12208      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
dya  Drosophila yakuba
Pathway
dya04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dya00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Dyak_GE12208
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     Dyak_GE12208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 6530590
NCBI-ProteinID: XP_002091503
FlyBase: FBpp0257218 FBgn0229970
UniProt: B4P8W1
Position
2R
AA seq 907 aa AA seqDB search
MVYFLGDWGMGDSDLSSYQQHVPNIQQPQRIHGHDLLLQQQQQQLPQQQQQQQQQQQQQQ
QQQQELVAQISSSLSQVQPQLQFASGSSFLQQGSSPSPSQQQHGSVSSSSSLVTANLQQL
SVSSSNSSSSSSSNNNSASGNTPTKQQQQQTLLLPEAAAPAASAVVGKASKNPQLSKDLL
DNEDEVALHPLSNQVGGHTRLLLLNQSTVIKPLNLRELDFYQNIPQDILKFVPKYKGVMQ
ATTMGGAKLDKRYSPSFRDDAAAVPVRKMSASKRKRDEVLRMKVHKNGQAAEVIKSISQL
DNTNKQYFLMLENITSQFRNPCILDLKMGTRQHGDDASAEKRSKQMAKCAASTSGSLGVR
LCGMQTYLADLEQYAKRDKYWGRELNEGGFKTALHDFFHNGYRLRIRVIRKILQRLLQLR
RVIEKQSSYRFYSCSLLIVYEGFEENPMAYPPSMGLDEWPEAPRSATVPGTVFDYHPENS
IDEDDLEDEDEAGNEAGDELEAHDTDEDLHLVAADSGNASATNSSTGGDACNYDADASND
SNSLLDLATRRHLHKRGFAEAAARGVKQTAAHNTTTDEEEEEEHPAMPPPRTCGVMAAKA
AAAAAGLAGKGQGAFIPISEETVFLDPEPALPSVTTSSPHSGDSWMNYSSNSSDDFSGLS
EQIKAVASGRQTCNNSSDDASSDYESSIIGPTEAMFKRYKSQQSFDAATAAESASSPPLT
AGNSSVSNGGTTVRSLVSPASSSASSLKSVKGAVKRLRCNDDDQQSASLGESDLREAKKS
TITSTPVSAVSSPAKTAPQLRSCESISNQQSLLSGLLLDNNNEQRRNALLQQSSKSLDMS
APPTDDNQCFVDVRLIDFAHTAFVPRNGTMLPTPAAAPVHHGPDGGFLTGLDSLNRLLNE
ILAEERI
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggtatatttcttgggggattggggcatgggagattctgacttgtcgtcatatcagcaa
catgttccaaatatacagcagccgcaacgcatccatggacatgatctactcttgcaacag
cagcagcagcagctcccacagcagcagcagcagcagcaacagcagcaacaacaacagcag
cagcaacagcaagaacttgttgcacaaatctccagtagcctaagccaagtgcaaccgcag
ttgcagtttgccagcggctcaagcttcctgcaacagggctcatctccctcgccatcccag
cagcaacatggttcagtcagcagcagcagcagcctcgtaactgccaatctccagcagctg
tcggtgagcagcagcaactccagcagcagcagcagtagcaacaacaacagcgccagtggc
aacactcccaccaaacagcaacagcagcaaacactactgctcccagaggcagctgctcct
gctgccagcgctgttgtcggcaaggcgtccaagaacccacaactgagcaaggatctcctg
gacaatgaggatgaagtggcattgcacccgctctccaaccaggtcggaggacacactcgc
ctgttgctgctcaaccagtcgacggtgattaagccgctgaacctgcgcgaattggacttc
taccagaacattccgcaggacatactgaagtttgtgcccaagtacaaaggcgtcatgcag
gccaccaccatgggcggagccaagctggacaagcgctactcgcccagtttccgggatgac
gcggccgccgttcccgtgcgcaagatgagcgcctccaaaaggaagcgggatgaggtgctg
agaatgaaggtgcacaagaacggacaagcagctgaggtgatcaagagcatctcacaactg
gacaacaccaataagcaatacttccttatgctcgagaacatcacctcgcagttccgcaat
ccctgcatcctggacctgaagatgggcactcgtcagcatggagatgatgcctccgcggag
aagcgctccaagcagatggccaagtgcgcggccagcacttccggatcgctcggtgttcgt
ctgtgtggaatgcagacctacctggccgacctggagcagtatgccaagcgtgacaagtac
tggggccgcgagctaaacgagggcggcttcaagactgcgttgcacgatttctttcacaat
ggctaccgcctgcgcatacgcgtcattcgcaagattctgcagcggctgctccagttacga
agggtgattgagaagcagtcgagctacagattctactcttgctcactgctcattgtgtac
gagggcttcgaggagaacccgatggcttacccaccctccatgggtctggatgagtggcca
gaggctcccaggtcggccaccgtgcctggcaccgtcttcgattatcatccggagaacagc
atagatgaggacgacctggaggatgaggacgaggctggcaacgaggctggcgatgagctg
gaggcgcatgacaccgacgaggatctgcatctggtggccgccgacagtggcaacgcatcg
gccacaaacagcagcacaggtggcgatgcctgcaactatgatgcagatgcctccaacgat
tccaactcattgctcgacctggctaccagacgtcacctgcacaagcgtggatttgcagaa
gcagcggcaaggggagttaagcagactgcggcccacaacaccaccaccgacgaagaggag
gaggaagagcatccggcaatgccaccgcctcgtacttgtggtgttatggccgccaaagcg
gcagccgctgccgctggcctggctggaaagggccagggcgcattcattccaatctccgaa
gagacagtatttctggacccagaaccagcgctgcccagcgtgacgacttcatcgccacat
tccggtgactcatggatgaactatagcagcaatagcagcgacgacttctccggactatcc
gagcagataaaggctgtcgccagtggccggcagacatgcaataacagcagtgatgacgca
agttcagattacgaaagcagtatcattggtcccacggaggccatgtttaagcgctataag
tctcagcaatcttttgacgccgccacagctgccgaatctgcatcctccccgccactcact
gccggaaactcgagcgtttctaatggcggcaccaccgtccgctcactggtttcgcccgcc
tcatccagcgcctcttccctgaaatcggtcaagggtgcggtaaagcggctacgatgcaat
gacgacgatcagcagtctgcgagcctaggggaatcggatttacgagaagcgaagaagtcg
acgatcacttcgacgcccgtttcggccgtatcctcgcctgctaagacagccccacaactg
cgaagctgcgagagtatctctaaccagcaatctctgctgtcgggtctactcttggataat
aacaatgagcagcgtcgcaatgcactcctgcagcaaagctcaaagtcgctggacatgtcg
gcaccgcccactgatgataaccaatgcttcgtggacgtccgcctcatcgactttgcccac
acggcatttgtgccgcgcaatggcaccatgctacccactccggcggcagctccggtgcac
catggacccgatgggggattcctcaccggcctagacagcctcaaccgcctgctcaacgag
attctggccgaggagcgcatctaa

DBGET integrated database retrieval system