KEGG   Drosophila yakuba: Dyak_GE13443Help
Entry
Dyak_GE13443      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20730  beta-hexosaminidase Fdl [EC:3.2.1.52]
Organism
dya  Drosophila yakuba
Pathway
dya00511  Other glycan degradation
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dyak_GE13443
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dyak_GE13443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 6530094
NCBI-ProteinID: XP_002091040
FlyBase: FBpp0258453 FBgn0231117
UniProt: B4P590
Position
2R
AA seq 671 aa AA seqDB search
MGYESLRYLYKMSLAVSLRRALLVLLTGAIFILTVLYWNQGATKAQAYNEALERPHSHHD
ASGFPIPVEKSWTYKCENDRCMRVGHHGKSAKRVSFISCSMTCGDINIWPHPTHKFLLSS
QTHSFSVEDVQLHVETSHREVRKQLQLAFDWFLKDLRQIQRLDYVGSSSEPTVSESSSKS
RHHADVDPAATLFGATFGVKKVGDLTSIQVKISVLKSGDLNFSLDNDETYQLSSLTEGRR
LQVEITANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHF
FSVESIKRTIVGMGLAKMNRFHWHLSDAQSFPYISRYYPELAEHGAYSESETYTEQDVRE
VAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQPWSFYCGEPPCGQLNP
KNNHTYLILQRLYEELLQHTGPTDLFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAMA
RLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHV
DAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRRKQVLGGEVCMWTEQV
DENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEALFP
KYCAQNPGECI
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgggatacgaaagcctacgctatctctataagatgtccttggctgtatcgctgcgccga
gctctgttggtgctgctcaccggcgccatattcatcctgacggtgctctactggaaccaa
ggagccaccaaggcccaggcttacaatgaggcgctggaacgcccccacagccatcacgat
gccagtggctttcccatacccgtcgagaagtcctggacgtacaagtgcgagaatgaccga
tgcatgcgggtgggccatcatggaaaatccgccaagagggtctcgttcatcagctgctcg
atgacgtgcggtgacattaacatttggccgcaccccacccacaaattcctgctcagctcc
cagacgcacagcttctccgtggaggatgtgcagctgcacgttgagacgtcgcatcgcgag
gtgcgcaagcagctccaactggcttttgactggttccttaaggatctgaggcaaatccag
cggctggactacgtgggtagttcatcagagccgaccgtaagcgaatcctcttcgaagtca
cgccaccatgcagatgtggatccagctgccacgctttttggtgctacctttggggtgaag
aaggttggtgatttaaccagcatacaggtcaagatcagcgtgctcaagtccggagacctt
aactttagcctggacaatgatgagacctaccagcttagctccctaaccgaaggacgccgc
ctgcaggtggagatcaccgcaaactcctacttcggagcccggcatggactgtctacgctg
cagcaactgatatggtttgacgacgaagatcacctgttgcacacttatgccaatagcaag
gtgaaggatgcccccaagttccggtatcgaggcctcatgctggacacctctcgccacttc
ttctctgtggagtccatcaagcgcacgattgtgggcatgggcctggccaagatgaaccgc
ttccactggcacctctctgacgcccagagtttcccttacatttcgcgctactatccagag
ctggccgagcatggagcttactcggagagcgagacgtacacggaacaagatgttcgcgag
gtggccgagttcgccaagatttatggtgttcaagtcatacccgagatcgatgcgcctgcc
catgcgggcaacggctgggattggggacccaagcgtggaatgggcgagctggccatgtgc
atcaaccagcagccatggagcttctactgcggcgaaccgccgtgcggacagctgaatccg
aagaataaccatacctacctcattctgcagcgcctctacgaggagttgttgcaacacaca
ggtcccacggacctcttccacctgggcggtgacgaggtgaatcttgattgctgggcccaa
tacttcaacgatacagatcttcgcggattgtggtgcgatttcatgctccaggctatggct
agactaaaactggccaacaatggagtagcgcccaagcacgtggctgtctggtcgagcgcc
ctgaccaacaccaagtgtcttccaaacagtcaattcaccgtccaggtatggggcggcagc
acttggcaggagaactacgatttgctggacaacggctacaacgtaatcttctcgcacgtt
gacgcctggtatctggactgcggcttcggtagctggcgggccactggggatgccgcctgt
gctccgtaccgcacttggcagaatgtctacaagcacaggccgtgggagcgcatgcgattg
gacaagaagcgaaggaagcaagtgctcggtggcgaagtgtgcatgtggaccgagcaggtg
gacgaaaaccagctagacaaccggctgtggccccgaacagccgctctggcggagcgcttg
tggaccgatcctagcgatgatcacgatatggacatagtgccgccagatgtattccgcaga
atctcactgtttcgaaatcgcctcgtcgaactgggcatccgggctgaagcgctgtttcca
aaatactgtgcccagaatcccggcgaatgcatttga

DBGET integrated database retrieval system