KEGG   Drosophila yakuba: Dyak_GE13731Help
Entry
Dyak_GE13731      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dya  Drosophila yakuba
Pathway
dya00040  Pentose and glucuronate interconversions
dya00053  Ascorbate and aldarate metabolism
dya00830  Retinol metabolism
dya00860  Porphyrin and chlorophyll metabolism
dya00980  Metabolism of xenobiotics by cytochrome P450
dya00982  Drug metabolism - cytochrome P450
dya00983  Drug metabolism - other enzymes
dya01100  Metabolic pathways
Module
dya_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE13731
   00053 Ascorbate and aldarate metabolism
    Dyak_GE13731
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dyak_GE13731
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE13731
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dyak_GE13731
   00982 Drug metabolism - cytochrome P450
    Dyak_GE13731
   00983 Drug metabolism - other enzymes
    Dyak_GE13731
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dyak_GE13731
Glycosyltransferases [BR:dya01003]
 Others
  Hydrophobic molecule
   Dyak_GE13731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_trans_4_4 Glyco_transf_4 RSN1_TM Glyco_trans_4_2
Motif
Other DBs
NCBI-GeneID: 6530664
NCBI-ProteinID: XP_002091562
FlyBase: FBpp0258741 FBgn0231385
UniProt: B4P9F4
Position
2R
AA seq 530 aa AA seqDB search
MQIRLLFSLLLAGTLYSQLKSTEGSKILAVYAFPGKSHFMMHTALIRELVESGHQVTMVT
AFTLEKEKLGSNYTEILIEPVYDFWHDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTT
EHALRQPKVQALINAEQKDGVFDLLLAEQFYQEAFLALAHLYKIPVVTTSTLGYENHMSQ
MMGLITPWSFVPHGFMPFTDRMSFLERVKNSYASFYEDMDRLLNYFPKMDAVTREFFGPV
LAEVPKVKHMEREISVMLLNSHAPLTTARPTVDAMVPVGGMHIYPPKPLPADMQAFLDGA
TEGAIFFSLGSNVQSKDMPVEMLRLFLQVFGSLKQRVLWKFEDESIRQLPENVMVRKWLP
QADILAHRNVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAVLGGYAISLHFQ
SITEEILRHSLNHLIHNATYKENVQRVSDIFRDRPQEPRKSAVYWIEYVIRHRGAPHMRS
AGLDLNWFQFYLLDVIAFVAIIALAGIMALSLAIRLLMGSNKKHKKAKQN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcagattcgattattatttagcctgctgctggctggcaccctatattcccagttgaaa
tcaactgagggatcaaaaattctggctgtgtatgcctttccggggaaatcacattttatg
atgcacactgccctaataagggaactggtggagagtggtcatcaggttaccatggtaaca
gcctttactctggagaaagagaaacttggcagcaactacacggagatcttgatagaaccg
gtctacgatttctggcacgatgttaagcttaactttggagcccagcacttattcgagctg
acccgcatgaccaactatgatttcctaaagatgctggagattatcggtctcaagaccacc
gaacatgccctacgccagcccaaagttcaggcactcatcaatgccgagcagaaggatggg
gtctttgatcttctcctggccgaacaattctatcaggaggccttcttggctctggctcac
ctatataaaatacccgtggtgaccacgagcacgttgggctatgagaaccacatgagtcag
atgatgggtttgattacaccatggtcatttgtgccacacggttttatgcccttcaccgat
cgcatgagtttcctggaaagggtgaagaattcctacgcatccttctacgaggacatggac
aggttgctgaactattttccgaaaatggatgcggtgaccagggagttctttggacctgta
ttggccgaggtgcccaaggtcaagcacatggagcgggaaatctcagtgatgctactaaac
agtcacgcaccgctgaccacggcacgtcccacagtggatgccatggtgccagtgggtggc
atgcacatctatccacccaaaccgctcccggccgacatgcaagcctttttggatggcgcc
accgagggggccatcttcttcagccttggcagcaatgtccagagcaaggacatgcccgtg
gaaatgctgcgactgttcctgcaggtatttggttccctcaagcagcgggtattgtggaaa
ttcgaggacgagagcattaggcaattgccagaaaacgtgatggtcaggaagtggctgcca
caggcggacattctggcccatcgcaatgtgaaggtattcattacccacggtggtttgttt
ggcacccaggagggagtgcactacgctgtgcccatgctgggtatacccttctattgtgat
cagcaccttaatatgaacaaagctgttttgggtggatatgccattagtctgcacttccag
tcgattaccgaggaaatccttcggcactccctgaaccatctaatacataatgcgacctac
aaggagaacgttcaaagggtatcggatatttttcgggatcggccgcaggagccgcggaaa
agtgccgtctattggatcgagtatgtcatccggcatcgaggtgctccccatatgagatcc
gcgggcctggatctcaattggttccaattctacttgctggatgtcatagcatttgtggct
atcattgctctagctggaatcatggctctctcattggccattcgattactgatgggcagt
aacaagaagcacaagaaagctaaacaaaattga

DBGET integrated database retrieval system