KEGG   Drosophila yakuba: Dyak_GE13802Help
Entry
Dyak_GE13802      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dyak_GE13802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Gram_pos_anchor
Motif
Other DBs
NCBI-GeneID: 6527109
NCBI-ProteinID: XP_002088202
FlyBase: FBpp0258812 FBgn0231454
UniProt: B4P0F6
Position
2L
AA seq 679 aa AA seqDB search
MASEQTIDGAAAIPSGTGDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPTRSYSIQP
TTVCTTSASDNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEE
CDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVDLTGLNYAVFGLGNK
TYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGIEGG
GEEVLIRQYRLLEQPEVQPDRIYTGEIARLHSIQNQRPPFDAKNPFLAPIKVNRELHKGG
GRSCMHIELSIDGSKMRYDAGDHVAMFPVNDKSLVEKLGELCKADLDTVFSLINTDTDSS
KKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKY
QSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVLV
EYKTPTGRINKGVATTYLKNKQPQGSEEVKVPVFIRKSQFRLPSKPETPIIMVGPGTGLA
PFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDQ
GKKVYVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADA
VQYIKKMEAQKRYSADVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagcaaacgattgatggagcagccgcaatccccagcggcaccggcgacgaa
cccttcttgggcctgctggacgtggccctactggcggtgctcatcggcggagcagccttc
tacttcctgcgcagccgcaagaaggaggaggagccaaccaggagctattccatacaaccc
accacagtgtgcaccaccagtgcgtcggacaattcgttcatcaagaagctgaaggcatcc
ggacgcagtctggtcgttttctatggttcgcaaaccggaaccggcgaggagttcgctggc
cgtctggccaaggagggcattcgttaccggctgaagggcatggttgccgatcccgaggag
tgcgacatggaggagctgctgcagttgaaggacatcgacaactccttggcggtcttctgc
ctggccacctacggcgaaggcgatcccactgacaacgccatggagttctacgaatggatc
accagcggcgatgtcgatcttaccgggctaaattatgcggtcttcggcttgggaaacaag
acctacgagcactacaacaaggtggccatctatgtggacaagcggctggaggagctgggc
gccaaccgggtctttgaactgggcctgggcgacgatgatgccaacatcgaggatgacttc
atcacgtggaaggaccgcttctggcccgccgtgtgcgaccacttcggcatcgagggcggc
ggcgaggaagtgctcatccgtcagtaccgtctgctggaacagccagaggtgcagcccgac
cgcatatacacgggagagatcgcccgtctgcactcgattcagaatcagcgaccgcccttc
gacgccaagaaccccttcctggcccccatcaaggtcaaccgcgagctgcataagggcggc
ggtcgttcctgcatgcacatagagctgagcatcgatggctccaagatgcgctacgatgcc
ggagaccatgtggccatgttccctgttaacgacaagagtctggtggagaaacttggcgag
ctgtgcaaagccgatctggatactgtgttctcgctgatcaacaccgatacggacagcagc
aagaagcacccattcccttgccccaccacgtaccgcaccgctctgacccactacttggaa
attacggctataccccgcacgcacatcctcaaggagctcgccgagtattgtactgacgag
aaggaaaaggagttgctgcgcagcatggcatccatcagtcccgaaggaaaggagaaatac
cagagctggattcaagacgcatgtcgcaacattgtccacattctggaagacatcaaatcc
tgtcgcccacccattgatcatgtttgcgaactgctgccccgcttgcagccccgttactac
tccatctcgtcgtctgctaagctgcaccctactgatgtccacgtgacagccgttctcgtg
gagtacaagactccgacagggcgcatcaacaagggcgtggccaccacatatctgaagaat
aagcaaccccaaggcagtgaggaggtaaaggtgcccgtcttcatccgcaagtcgcagttc
cgtttgccttcgaagccggagacacctatcattatggtgggtcctggcacgggcttggcc
cccttccgcggtttcatccaggagcgacagttcctgcgcgatgagggcaagaccgtgggc
gagtcgattctctacttcggctgccgtaagcgcagtgaggattacatctacgaatccgag
ttggaggagtgggttaagaagggtactctcaacctgaaggctgccttttcccgcgaccag
ggcaagaaggtctatgtacagcacctgcttgaacaggacgcagatcttatatggaacgtg
attggcgagaataagggacacttctacatctgcggtgatgcgaagaacatggccgtggac
gttaggaacattttagtgaaaattttgtccacaaagggtaacatgagcgaggctgacgcc
gtgcagtatatcaagaagatggaggctcagaagcgctactcggccgatgtgtggagctaa

DBGET integrated database retrieval system