KEGG   Drosophila yakuba: Dyak_GE14132Help
Entry
Dyak_GE14132      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
dya  Drosophila yakuba
Pathway
dya00260  Glycine, serine and threonine metabolism
dya00330  Arginine and proline metabolism
dya00472  D-Arginine and D-ornithine metabolism
dya01100  Metabolic pathways
dya04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dyak_GE14132
   00330 Arginine and proline metabolism
    Dyak_GE14132
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Dyak_GE14132
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Dyak_GE14132
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dyak_GE14132
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Dyak_GE14132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 6527026
NCBI-ProteinID: XP_002088121
FlyBase: FBpp0259142 FBgn0231755
UniProt: B4P006
Position
2L
AA seq 341 aa AA seqDB search
MPNIAVIGAGVNGVASAIKILEHFVNEGQTPIRLTIISEDFTPNTTGDGSAGLWGPYLLG
GTSQSKVYKWSKSMHQFLEQIWLSDDAGEAGVCLLPCIRLSTSTVDTVEDFWRDIVYGAV
DLSKEQLAAYNKDRSVKFTSGLSFVTYTSEPIKLLPYLMKRFVRNGGVVVRKRITDLEAF
VADSEYDVIVNCSGLGSRTLLNDEQMYAVRGQVSRVKANWIFSSVLDESDDGNYIIPNTE
SVVLGGTHQERDYNTQVCQKDRRMIVNGCRRYIPGLEHTECLFDWVGLRPGRSQLRLEAE
RRGRKLLIHNYGHGGSGVTLCWGCADDVLDILLAAKNGSKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacattgcagttatcggtgcgggggtaaatggtgttgccagtgccattaagata
ctggagcacttcgtgaacgagggacagacaccgataaggcttacaattatatcggaggac
ttcacgccgaacaccacaggagatggttcggcgggtctctggggtccctaccttctcggc
ggcacttcacagtcgaaagtctacaagtggtcgaagagcatgcaccagtttctggagcag
atctggctgagcgacgatgccggagaggctggcgtctgtctgctgccctgcattcggctg
agcacctcgacggtggacacggttgaggatttctggcgcgacattgtctatggagccgtg
gatttgtccaaggaacaactggctgcatacaacaaagatcgcagcgttaagttcacgtca
ggcttatccttcgttacctacacctcggagcccattaagctactgccgtacttgatgaag
cgctttgtccgcaacggaggtgtagttgtccgtaaaaggataacggacctggaggcattt
gtcgccgactccgagtacgatgtgatagtcaattgctctggattaggatccaggactcta
ctgaacgacgagcaaatgtacgcagtacgtggccaagtgtcccgggtgaaggcgaactgg
attttctcgtccgtgctggacgagagtgatgatggcaactacataatacccaataccgag
agcgttgtccttggcggaacgcatcaggagcgggactacaacacacaggtctgccagaag
gacaggcggatgattgtgaatggctgccggcggtacattccgggtctggagcacacggag
tgccttttcgactgggtgggtctacgaccaggtcgcagccaactcaggctggaagccgag
cgccgtgggcggaaactgctcatacacaactatggacatggcggcagtggagtcactttg
tgctggggctgtgcggatgatgttctcgatatcctgttggccgccaagaacggctccaaa
ctatga

DBGET integrated database retrieval system