KEGG   Drosophila yakuba: Dyak_GE14406Help
Entry
Dyak_GE14406      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dya  Drosophila yakuba
Pathway
dya00040  Pentose and glucuronate interconversions
dya00053  Ascorbate and aldarate metabolism
dya00830  Retinol metabolism
dya00860  Porphyrin and chlorophyll metabolism
dya00980  Metabolism of xenobiotics by cytochrome P450
dya00982  Drug metabolism - cytochrome P450
dya00983  Drug metabolism - other enzymes
dya01100  Metabolic pathways
Module
dya_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE14406
   00053 Ascorbate and aldarate metabolism
    Dyak_GE14406
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dyak_GE14406
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE14406
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dyak_GE14406
   00982 Drug metabolism - cytochrome P450
    Dyak_GE14406
   00983 Drug metabolism - other enzymes
    Dyak_GE14406
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dyak_GE14406
Glycosyltransferases [BR:dya01003]
 Others
  Hydrophobic molecule
   Dyak_GE14406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 6526978
NCBI-ProteinID: XP_002088074
FlyBase: FBpp0259416 FBgn0232014
UniProt: B4NZV9
Position
2L
AA seq 502 aa AA seqDB search
MKRSPVSLSLLWMGYTGIFLLADSPAPVEAHHILGVFVNVHRSQLMVHLAVCRALLQKGH
HLTLVTTWPLEEQEIRGNVSHIFIPWKQPAEEGSTSDLIGRLERMFKRLEHSGDLLDLPE
WKTFLSNPPQTPYDLLLLGYHFNDHLLGLAAHFNCPVAIVSTQQPTGFVNSLMGNPEERW
YVPQPYDGHQRSGMSACVFGIWEKFIEMMARRVLARIYSLHFPEPRYPSFETMRRSVVLA
LSNHHMISEGPIAPLIPSMVDIGGIVLEQQLSKTPLELPAGNRSLIIFSLGTRFTWRKST
EELVQTFTKAFSQFPDYDIYWTYDGPNGSAISLDYPHLKVAKWWPQSQLLQSGRARLFIT
HGGKGSLSEALFHGVPMLGLPLIGDQRANLRRMQSRNWGLTLSTHNLTHLELAKGISRML
TNSSYSETILKASQVYRDRPMNSSDLATYWIEYIVRHKGAKNLYNPARQLNMIEYHSIDM
YFMVYGFLMLTIAMLRKVNRLL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggtcgccggtcagtttgtcacttctatggatgggctacacaggcatttttctg
ctggctgatagcccagccccagtggaagcccatcacattttgggtgtctttgtcaatgtg
caccggtcgcagctaatggtccatttggcggtgtgtcgggctctgttgcagaagggtcac
cacttaaccctggtcaccacatggccgctggaggagcaggagattcggggtaatgtgtca
cacattttcattccttggaagcagccggcagaggagggatccacctcggaccttattggg
cgtctggaaaggatgtttaagcggctagaacattcgggagatctgctggatctgccggag
tggaagacgtttcttagcaatccacctcaaactccctatgatctgctccttttgggctat
catttcaacgatcatctgttgggactggcagcacacttcaactgtccagtggctatcgtt
tccacccagcagccaactggatttgttaacagcctcatgggcaatcccgaggagcgttgg
tatgtcccacagccgtatgatggccaccagcgaagtggcatgtcagcctgcgtgtttgga
atttgggagaagttcatagaaatgatggcgaggagggtgctggcaaggatctacagtttg
cactttcccgagccgcgataccctagttttgaaacgatgcgccgatcggtggttctggcc
ctaagtaatcatcacatgatcagcgagggtcccatagcaccattaatacccagcatggtg
gatataggcggtatagtgctagagcaacagctaagtaagactccactggaactcccagct
ggcaatcgatctctgatcatcttcagtttgggcactcgtttcacttggcggaagtcaact
gaagaactggtgcagactttcacaaaagctttctctcagtttccggactatgacatttac
tggacctacgatggacccaatggtagtgccatcagtttggattatccccatttgaaggtc
gccaagtggtggccccaatcccagttgttgcaaagtggcagagctcgactgttcatcact
catgggggcaaaggaagtctctcggaagctcttttccatggagtgcccatgctgggacta
cctttaattggggatcaacgcgccaatcttcggcgaatgcagtccagaaactggggattg
accttatccactcacaatctcacgcacttggaactagcgaagggcatttctagaatgctt
accaattcgagttacagtgaaactatattgaaagcttcgcaagtgtatcgcgatcgtccc
atgaactccagcgatttggccacttattggatcgagtacatcgttcgacataagggagct
aaaaatctgtacaatcccgccaggcaacttaatatgatcgaatatcactccatcgatatg
tatttcatggtttatggattcttaatgctaacgattgccatgctcagaaaagtaaatcgc
ttgctgtga

DBGET integrated database retrieval system