KEGG   Drosophila yakuba: Dyak_GE16341Help
Entry
Dyak_GE16341      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dya  Drosophila yakuba
Pathway
dya00562  Inositol phosphate metabolism
dya01100  Metabolic pathways
dya04070  Phosphatidylinositol signaling system
dya04310  Wnt signaling pathway
dya04745  Phototransduction - fly
dya04933  AGE-RAGE signaling pathway in diabetic complications
Module
dya_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dyak_GE16341
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dyak_GE16341
   04070 Phosphatidylinositol signaling system
    Dyak_GE16341
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Dyak_GE16341
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dyak_GE16341
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dyak_GE16341
Membrane trafficking [BR:dya04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    Dyak_GE16341
 Endocytosis
  Macropinocytosis
   Phospholipase C
    Dyak_GE16341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y DUF1154 EF-hand_like C2
Motif
Other DBs
NCBI-GeneID: 6524245
NCBI-ProteinID: XP_002100108
FlyBase: FBpp0261351 FBgn0233871
UniProt: B4Q064
Position
X
AA seq 1095 aa AA seqDB search
MTKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGR
DGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHV
ICPDAATAKIWLDGIRKITHNVKANNICPMMCLRKHWMRLSYCVEKSGKIPVKTLAKTFA
SGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQ
DFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKR
YLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGC
RCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNR
AQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKKKILIKNKRMKPEVEKVEL
ELWLKGELKTDDDPEEDASAGKPPEAAAAPAPAPEAAAATEGAAEGGGGAEAEAAAANYS
GSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYN
KRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLL
KPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVK
KEFRTRLVANNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAG
YRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKAL
GIEEQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKH
AKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNSINDQTKQWTDMIARHRKEEWDMLR
QHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTK
NEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQVEEFSTDVQKLMDMYKI
EEEAYKTQGKTEFYA
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaagtacgagttcgattggatcattccggttccgccggaattgaccacgggc
tgtgttttcgatcgctggttcgagaacgagaaggagacgaaggagaatgactttgagcgc
gatgccctcttcaaggtcgacgaatacggatttttcctgtattggaaaagcgagggccgg
gatggcgatgtcattgagctctgccaagtgagcgacattcgtgcgggaggaacacccaag
gatccgaagatactcgataaggtgaccaagaagaacggcaccaatataccggaactggat
aagcgttccctgacgatctgttcgaacacggactatatcaatataacatatcaccatgtt
atttgtccagatgcggcaacagccaagatctggctagatggcatacgaaaaataacccat
aatgtcaaagcgaacaatatctgccccatgatgtgtctgcggaaacattggatgcgattg
agttactgtgtagagaagagtggcaaaattccggttaaaacgctggccaaaaccttcgca
tccggcaaaacggagaaattggtgtacacgtgcataaaggatgccggtctgcccgatgac
aaaaacgcaacgatgaccaaggagcagttcaccttcgacaagttctacgccttgtaccac
aaggtgtgtccccgaaacgacattgaggagctcttcacctccatcaccaagggcaagcag
gactttatcagcttggagcaatttatccagttcatgaacgacaaacagcgtgatccgcgg
atgaacgagatcctgtatcctctctacgaggagaaacgctgcacggagatcatcaacgat
tacgagttggatgaggaaaaaaagaaaaacgttcaaatgtcgctggatggatttaagcgc
tacttgatgtccgacgagaacgcacctgtattcctggaccgtctggatttctacatggaa
atggatcagccactggcccattactatatcaacagctcgcataatacctacctatccggc
cgtcagatcggcggcaaaagttccgtggaaatgtaccgccagacactcttggcaggctgt
cgatgtgtggagttggattgctggaacggaaagggtgaggacgaggagccaatcgtcacc
cacggccacgcctactgcaccgaaattctctttaaggactgcatccaggcgattgcggac
tgcgccttcgtgtcctccgagtacccggtaattctgtccttcgaaaaccactgcaaccgc
gcccagcaatacaagttggccaaatactgtgatgacttctttggcgacctgctgctgaag
gagccgctaccagatcacccgctggacccgggtcttccgctaccgccaccctgtaagctg
aagaaaaagatcctcatcaagaacaagcgaatgaagccggaggtggaaaaggtcgagctg
gagctctggctgaagggcgaacttaagacggacgacgatccggaggaggacgccagtgca
ggcaagcccccggaggcagctgccgcccccgctcccgccccggaagcagccgccgccacc
gaaggagccgccgagggaggcggtggtgcggaggccgaagccgccgctgccaactacagc
ggctccaccaccaacgtgcatccgtggctctcctccatggtcaattacgcgcagcccatc
aagttccagggcttcgacaaggcaatcgaaaagaacattgcccataacatgtcctcgttt
gcggaatcggcgggcatgaactacttgaagcagagctctatcgactttgtcaattacaac
aagcgtcagatgtcgcgaatttacccgaagggcacgagagcggactcctcaaactatatg
ccgcaggtgttttggaacgccggctgccagatggtctcactcaacttccagagctccgac
ctacccatgcaactcaaccagggcaagttcgagtataacggcggctgtggctatctactg
aagccggatttcatgcgtcgagccgacaaggattttgatccatttgccgatgcgccggtg
gatggcgtgattgccgcccagtgctccgtgaaggtaatagccggccagttcttgtccgac
aagaaagtgggcacctatgtggaggtggacatgtttggattgccctcggacacggtgaag
aaggagtttcgcacgcgtttggtggccaataatggcttgaatccagtttacaatgaggac
ccctttgtgttccgcaaagtggtacttccggacttggctgtgctgagatttggcgtttat
gaggaaagcggaaagatcctgggtcaacgtatcctgccgctagacggtctacaggctggc
tatcgtcatgtttccctgcgcacggaggctaacttccccatgtcgttgcccatgttgttc
gtgaatattgagctaaagatctacgtacctgacggctttgaggacttcatggccatgttg
tcggatccgcgaggattcgccggtgccgctaagcagcaaaatgaacagatgaaggccctc
ggcattgaggagcagagcggcggtgccgcccgagatgctggcaaggccaaagaggaggaa
aagaaggagccaccacttgtctttgagcccgtcacgttggagtctctgcgccaggaaaag
ggcttccaaaaggtgggcaaaaagcagatcaaggagctcgacaccctgcgcaaaaagcac
gccaaagagcgcacctcggtgcaaaagacccagaatgcggccatcgataagttaatcaag
ggcaagagcaaagacgacattcgcaacgatgccaacatcaagaactcgatcaatgatcag
acgaaacagtggaccgacatgatcgccaggcaccgcaaggaggaatgggacatgctgcgc
cagcatgtccaagattcgcaggatgcaatgaaggcgctgatgctcactgttcaggcggcg
cagatcaagcagctggaggatcgtcatgccagggatatcaaggatctgaatgccaagcaa
gcgaagatgtcggcggataccgccaaggaggtccagaacgacaagaccttgaagaccaag
aacgagaaggatcgtcggctgcgcgagaagcgtcagaacaatgtaaagcgcttcatggag
gagaagaagcaaatcggcgttaagcagggccgtgcgatggagaaactaaagttggcgcat
tcgaagcaggtcgaggaattcagtaccgacgtgcaaaagcttatggacatgtacaaaatc
gaggaggaggcctataagacgcaaggaaagacggaattttatgcctaa

DBGET integrated database retrieval system