KEGG   Drosophila yakuba: Dyak_GE16582
Entry
Dyak_GE16582      CDS       T01068                                 
Name
(GenBank) uncharacterized protein, isoform E
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
dya  Drosophila yakuba
Pathway
dya00270  Cysteine and methionine metabolism
dya01100  Metabolic pathways
dya01230  Biosynthesis of amino acids
dya01240  Biosynthesis of cofactors
Module
dya_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dyak_GE16582
Enzymes [BR:dya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     Dyak_GE16582
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-ProteinID: KRJ97015
FlyBase: FBgn0234094
UniProt: A0A0R1DIG4
Position
2L
AA seq 408 aa
MPQKTNGHSANGCNGSNGNSYDMEDGATFLFTSESVGEGHPDKMCDQISDAILDAHLKQD
PNAKVACETVAKTGMILLCGEITSKAVVDYQKVVRETVQHIGYDDSSKGFDWKTLNLLVA
IEQQSPNIANGVHINREEEDVGAGDQGIMFGYATDETEECMPLTVVLAHKLNEKIAELRR
SDVFWWARPDSKTQVTCEYLFNQGSAVPKRVHTIVVSMQHSEKISLETLRSEVMEKVVKV
VIPAKYIDANTIVHINPCGLFVIGGPMGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDFTK
VDRSAAYAARWVAKSLVKAGLCKRCLVQVSYAIGLAEPLSITVFDYGTSHKSQKELLDII
RRNFDLRPGKIVKDLNLRQPIYQRTSTYGHFGRAGFSWEEAKPLETDN
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgccgcaaaagacaaacggacacagcgccaacgggtgcaacggcagcaatggtaactca
tatgacatggaagacggagctacattcctgttcacttccgagtccgttggcgagggtcat
ccagacaaaatgtgcgaccagatcagcgacgcaatcttggatgcccatctaaagcaggat
cccaacgcgaaggtggcgtgtgaaaccgtcgccaagacaggcatgattctgctgtgcggc
gagatcacgtcaaaggctgtggtcgactaccagaaggttgttcgtgagacagtgcagcac
atcggctacgatgactcctccaagggtttcgattggaagacacttaacctgcttgtagcc
atcgagcaacagtcgcccaacattgccaacggcgttcatatcaaccgcgaggaagaagat
gtcggcgctggtgaccagggaatcatgtttggatatgctacagacgaaaccgaggaatgc
atgcccctaaccgttgttttggctcacaaactaaacgaaaagattgccgagctgcgtcgc
tcagatgtcttctggtgggctcgccccgattccaaaacacaagtcacctgcgagtacctc
ttcaatcagggatcagcagttcccaagcgtgtccacactattgtagtgtctatgcagcac
tctgaaaagatttcgttagaaaccctgcgctcggaagtaatggagaaagtggttaaagtt
gtcattcccgccaaatacatcgatgcgaacaccattgtccacatcaatccatgtgggctc
tttgtcatcggtggaccaatgggtgacgctgggcttacaggacgaaaaatcattgtagac
acttacggaggctggggcgcccacggcggcggtgccttctctggcaaggacttcaccaag
gtcgacagatcagcagcatacgcagcacgctgggtggccaaatcactagtgaaggccggt
ctctgcaagcgctgccttgtccaagtgtcgtacgccataggtcttgctgaacctctctcc
ataactgtgttcgactacggaacttcccacaagtcacaaaaggagctcctagatatcatt
cgtcgcaactttgacctcaggcccggcaagattgtcaaggaccttaacctgcgccagcca
atataccagcgaaccagtacctatggacacttcggacgcgccggcttctcgtgggaggag
gccaagcctctggagactgataactga

DBGET integrated database retrieval system