KEGG   Drosophila yakuba: Dyak_GE16726Help
Entry
Dyak_GE16726      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Pathway
dya04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dyak_GE16726
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE16726
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE16726
Ubiquitin system [BR:dya04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dyak_GE16726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP7_C2 USP7_ICP0_bdg UCH UCH_1 MATH
Motif
Other DBs
NCBI-GeneID: 6523983
NCBI-ProteinID: XP_002099855
FlyBase: FBpp0352421 FBgn0234222
UniProt: B4PY90
Position
X
AA seq 1137 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEILTSDLQQQQQQQQQTPQQQQNSPPQLPKFKNLIQPQLH
AVGAVTQLPSENGNVPPQQLLADSSSTSFGDAEAMGIDDESKEDQFRSETTFSFTVENVV
QLKSQRLSPPVYVRMLPWRIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKSHKPD
AQPFSRARIKHLFYSKENDYGYSNFITWPELQDSDKSYVHNNSITLEVHVIADAPHGVLW
DSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSTKSVGLSLQRVFH
ELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTTLEGTIPGLFE
GKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHG
LQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEQINLDRYLAESEKTSA
DYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEIS
FHAKCSNAYMLVYIRQSELERVLGDIPENEISSDLVERLDLEKRIEMARRKERSEANLYV
SVHVNLEEYFDDQHKGRLFDLEKAHPRIFRIKQNQTVDELVDMFVKGFGVSRERMRMWNM
CTAQPQKFLHFDFVAEASRAIEQIPTSQKPWVIWLELAWPDVSGPLPSFNPKTEVLLFLK
YYDARNKRLNYIGCTQQPHTRRLIDLVPEVNRKLGFDADTELTIFDESADKKLVNLNEPI
ESVLFIPQDHLQGHILIFERENVDAKLDLPTVQDYFHDIVHRVEIIFSDKCNPNEPDFTL
KLSGRYNYDQLTNAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKGTIKDLVSYTKL
STPKRIFYQRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKI
TFAENSRRKLRLMKVSHHKIVAICKDDIPLDTLLKTNESITTTQGGQKAYRIEEVPAEEM
QLAENEFLIPVGHFSKELYNSFGVPFLAKARHGEPYGALKQRIQRRLNVPDKEWENYKFS
VISMGHNSDVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaacagatcagtctattgaagcaatggacacccaggacacccaagaggtc
gagatcctcaccagtgacctccagcagcagcagcaacaacaacaacagactccgcaacag
cagcagaattcgccgcctcaattgcccaaattcaaaaatcttatccagccacaattgcac
gccgttggcgctgtaacccagttgcccagcgagaacggcaatgtgccgccacagcaacta
ttggcggatagcagctccacttcgttcggcgacgccgaggccatgggcattgacgatgag
tccaaggaggatcagttccgctcggagaccacattctcctttaccgtcgagaatgtagtt
caattgaaatcgcagagactgtcgccgccagtgtatgtccgcatgttgccatggagaatt
atggtcatacccaatgatcgtgcgctgggcttcttcctgcaatgcaatggtgagaatgat
tcgcccacctggtcatgcaatgccattgctgagctgcgtttgaagagccacaagccggat
gcacagccattcagccgtgctcgcattaagcatttgttctactccaaggagaacgactat
ggctactcgaacttcatcacctggccggagctgcaggattccgacaagagctatgtgcac
aacaacagcatcaccctggaggtgcacgtaattgcggatgcaccgcatggcgttttgtgg
gactcgaagaagcacacaggctatgtgggcctcaaaaatcagggcgcaacctgctatatg
aactcgctgctgcagacattgtacttcaccaattctctaagactgtctgtgtatcgcata
cccacagaggctgacgatagcaccaaatcagttggactatcgctgcagcgtgtgtttcat
gaactgcagtttggtgaccgccccgtgggcaccaagaagctaaccaagtcctttggctgg
gagacgctcgattcgttcatgcagcacgatgtccaggagttccttcgcgtgctgctcgac
aagctcgagtcaaagatgaagggcacaacactggagggcaccataccgggtctgttcgag
ggcaaaatgtcttcgtacattaaatgcaagaacgttgactacaacagcacacgctacgag
acgttctacgacatccagctgaacatcaaggataagaagaacatctacgagtccttccag
gattacgtagctcccgagacgctggagggtgacaacaaatacgatgctggtgtgcatggc
ttgcaggaagccagcaagggcgtaatcttcacttcattcccacccgttttgcatctgcac
ctgatgcgcttccagtacgatcccgtcacggacagctcgattaagtacaacgatcgcttt
gagttctacgaacagatcaatctggatcgctacctagccgagagcgagaagacctcggcg
gactacgttctgcacgccgtcctggtgcactctggcgataaccatggcgggcactatgtg
gtcttcattaatccaaaggctgacggacgttggtttaagttcgacgacgatgtggtctcc
agttgccgcaagcaggaggcgatcgaacagaactacggcggtatggacgacgagatctcg
ttccatgcgaagtgcagcaatgcctatatgctggtctacatccgccaatcggagttggag
cgcgtccttggcgacataccagagaacgagatctcaagcgacctggtggagcgcctcgat
ctggagaagcgcatcgaaatggcgcgacgcaaggagcgcagcgaggccaacctttatgtg
tccgtgcacgtgaacctcgaggagtacttcgacgaccagcacaagggtcgcctcttcgat
ctggagaaagctcatccgcgcatcttccgcatcaagcaaaatcagactgtcgacgagctg
gtggacatgtttgtcaagggtttcggagtgtcgcgcgaacgcatgcgaatgtggaacatg
tgcaccgcccagccccaaaagtttttgcattttgatttcgtggcggaggcgtcacgcgcc
atcgagcagataccgacctcacagaaaccgtgggtcatctggctggagctagcctggccg
gatgtttctggtcccctgccgtcctttaatcccaagaccgaagtcctgctgttcctcaag
tactatgatgcgcgtaacaagcgcctgaactacattggatgtacccagcagccgcacacc
cgccgccttatcgatctggtgccggaggttaatcggaaactgggcttcgatgcggacacc
gagctgaccatcttcgatgagtccgccgacaagaagctggtcaatctgaacgagcccatt
gagagtgtgctgttcataccgcaggaccacctgcaaggccacatcctaatcttcgaacgt
gaaaacgtcgacgccaaactcgacctgcccacggtgcaggactacttccatgatatcgtc
catcgcgtcgagatcatcttcagcgacaaatgtaaccccaatgagccggactttacgctg
aagctgtccggtcgctacaactacgatcaactcaccaatgcggtggccgagcgcttgaat
accgatccacagaagctgcagttttttatgtgcatcaacaactacaaggaaacggcgggc
aatgcagtgccctacacatttaagggaaccatcaaagatctggtgtcctacaccaaactg
agcacgcccaagcgtattttctaccagcgcctgtcgctcagcatccatgagctggacaac
aagaagcagtttaaatgcgtctgggtgagcagcgacctcaaggacgagaaggaactggtg
ctgtaccccaacaagaacgatacggtaaagggactgctggaggaggcggccaagaagatt
acatttgcggagaacagtcgtcgcaagttgcgcctgatgaaggttagccatcataaaatc
gtggcgatatgcaaggatgatataccgctggatacgctgctaaagaccaacgagtcaatc
acgaccacacagggcggtcaaaaggcttatcgcatcgaggaggtgccggcggaggagatg
cagctggcggagaacgagttcctcatcccagtgggccacttcagcaaggagctgtacaac
tcgttcggcgtacccttcctagccaaggcacgccacggcgagccgtatggtgcgctaaag
cagcgcatccagcggcgtctgaatgtgccggacaaggagtgggaaaactacaaattctcc
gtgatctccatgggccacaattcggatgtgaacgacaatacgcccgtcgacctggaggtg
tatcgctcgtggaccagcggacagttgcccttctttggtttggatcacatcaacaagtcg
cgcaagcgcagctcgcttaacttttccgagaaggccatcaagatctacaactag

DBGET integrated database retrieval system