KEGG   Drosophila yakuba: Dyak_GE16871Help
Entry
Dyak_GE16871      CDS       T01068                                 

Gene name
Dyak_EG:EG0007.7
Definition
(RefSeq) EG:EG0007.7
  KO
K11304  histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE16871 (Dyak_EG:EG0007.7)
Chromosome and associated proteins [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dyak_GE16871 (Dyak_EG:EG0007.7)
   HAT complexes
    TIP60 complex
     Dyak_GE16871 (Dyak_EG:EG0007.7)
    NuA4 complex
     Dyak_GE16871 (Dyak_EG:EG0007.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_7 Acetyltransf_1 DUF2326
Motif
Other DBs
NCBI-GeneID: 6524264
NCBI-ProteinID: XP_002100127
FlyBase: FBpp0261881 FBgn0042723
UniProt: B4Q083
Position
X
AA seq 541 aa AA seqDB search
MKINHKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPG
SGTPAAIPVTPTGASGSVPPPAGIPSSVVPPGTPSSGGELVNGNNLAAALQKRINRKRKV
HGGSAHGHHSLPNQQQQSHPHPTTPQTPTATPVHVTGDGLISGAANEDGDGSQDGKTPTP
RQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMSCIYICEFCLKYRKS
RKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYD
TDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYEL
SKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITINDICECTSIK
KEDVISTLQNLNLINYYKGQYIVCINRDTIEQHRRAMDKRKIRIDSKCLHWTPKDWSKRS
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaccacaaatatgagttcgacgacgatgtggcctccatttgcgagtcaacg
gccgcccttaccgagggatgtcgcttgcccgtcagaatgcacaaaacggacgattggccg
ctggcggagattgtgagcatcaaagagttggacgggcgccggcagttttacgtgcactat
gtggatttcaacaaacgcttggacgaatgggtcaacgaagaggatctgtacacacgaaaa
gtgcaatttccgcggcgggacggctcccaaacgggcactagcaccggagtgacgacgccc
cagcgccaccattccttagcgggcagcgtttcccggcctacatcgccacaacatcctggt
tccggtactccggcagccatccccgtgactcccactggtgcatcaggcagtgttcctccc
cctgcaggtattcccagctctgtagttcctcccgggacacccagcagtgggggagagctt
gtgaatggcaacaatctggccgcagctcttcaaaagcgcatcaatcgcaaacgaaaagtc
cacggaggctcggcccatggacaccacagcctgccgaatcaacagcagcagtcacatccg
catcctacaactccacagacacccacggctacgcccgtgcatgtgaccggagacggtttg
ataagcggtgcggccaatgaggatggtgatggatcgcaggatggcaagacgcccacgccg
aggcaatcgggcagcatggttacgcaccaggacgacgtggtaacccgcatgaaaaacgtg
gagatgattgaactgggcaggcatcgcattaagccctggtatttctcaccctatccgcaa
gagctgtgtcaaatgtcctgcatctacatttgcgagttctgcctgaagtacagaaagagc
aggaaatgcctggagaggcacctgtctaagtgcaatcttaggcatccgccggggaacgag
atctaccgcaaacacacaatttccttctttgaaatcgacggccgcaaaaataaggtgtat
gcccagaacttgtgcctgcttgccaaactctttctcgaccacaagactctgtactatgat
acagatccgtttctcttctacgtaatgaccgagtttgactcgcgcggcttccacatagta
ggttacttttccaaggagaaggagagtaccgaggattacaacgtggcctgcattctcaca
atgcctccctatcagcgcaagggctacggcaaactgctcattgagttcagctacgagttg
tccaaatttgagggcaagacgggatcgccggagaaaccattgtctgatctgggtttgctg
tcgtatcgatcgtactgggcgcaaaccatactggagatctttatcagccaaaacccgagc
acggacggcgagaagcccaccataacaataaacgacatctgcgaatgcacatccatcaaa
aaagaggatgtgatctcaacgctgcagaacctaaacctgatcaactactacaagggccag
tacatcgtgtgcatcaaccgggataccatcgagcagcaccggcgcgcaatggacaagcgc
aagatccgcatcgactcaaaatgcctgcactggacgccaaaagactggtccaagcgctcc
aaatga

DBGET integrated database retrieval system