KEGG   Drosophila yakuba: Dyak_GE16872Help
Entry
Dyak_GE16872      CDS       T01068                                 

Gene name
Dyak_EG:EG0007.9
Definition
(RefSeq) EG:EG0007.9
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
dya  Drosophila yakuba
Brite
KEGG Orthology (KO) [BR:dya00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dya03016]
    Dyak_GE16872 (Dyak_EG:EG0007.9)
Enzymes [BR:dya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     Dyak_GE16872 (Dyak_EG:EG0007.9)
Transfer RNA biogenesis [BR:dya03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    Dyak_GE16872 (Dyak_EG:EG0007.9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 6524266
NCBI-ProteinID: XP_002100129
FlyBase: FBpp0261882 FBgn0042722
UniProt: B4Q0F3
Position
X
AA seq 746 aa AA seqDB search
MGRNKKQNPFAARKRQKRENGPERPDRRALPYEEIKRDNAFFIKYYHLQKICASEEEWSQ
FLESIRDNLPTTFRVTGFKDEAKALLSIIETQLFTEYVRAVAELHQKAPEDVERPLCLPW
YPNGLAYQLHLTRKDIRRSEPLYRLHNFLIVETTAGGISRQEAVSMIPPIVMDVRPTDKV
LDMCAAPGSKTAQLIEALHAAPEEHKIPPGFVLANDVDNNRCYMLVHQAKRLNSPCLLVT
NHDSSVFPNLLTTMPDGSKAILKFDKILCDVPCSGDGTLRKNPDIWLKWNLAQAYNLHGI
QYRIVRRGAEMLEVGGRLVYSTCSLNPIENEAVLQRIIKDADGALELVDAGHLVPGLKYK
PGMTDWKLATKEVDQIFTNFDEVPESLHTIIRPGMFPLPADEMAKIGLDKCLRVLPHLQD
SGGFFVAVLEKRRQLSFEKNDVVELVQLNEKAKQPAAEPQLDEEGKPVEEKSVPWGPQRK
KRRLHGYKEDPYVFFGENDPDYEAIKEFYQLNESLSQRCLLTRCITEKKKNIYYCSDPIR
DLVLNNENNIKIINTGVKTFVRCENRHTVHPFRLAQEGLQTSNAFMGANRRIQVEREDLV
MMLNCTDPTQPPSTHELKKETQERCKELGVGSCILKYVDERFTLYTVGWRGTSSLRAYVH
KDETIHILRLLGSDLSKFETNKYEDARVAAAAAADAEAGKSGEAEAGSSGEGAATESTSI
SGAVDVPEAAKTTSTPMDTEEVTTRS
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgaaacaagaaacaaaacccctttgcggcccgcaaacgccaaaagcgggagaac
ggtcccgagcgccccgatcgtcgggccctgccgtatgaggagatcaaaagggataatgcc
ttcttcataaagtactaccacttgcagaagatctgcgccagcgaagaggagtggtcgcag
ttcctcgaatccatcagggacaacctgcccactactttccgtgtgacaggattcaaggac
gaggccaaggccctgctttccattattgagacgcagctgtttaccgagtatgtgagggcg
gtggccgagctgcaccaaaaggcgcccgaggatgtggaacgtccgctctgcctaccctgg
tatccaaacgggctggcctaccagcttcacctcacccgaaaggacattcgacgctcggag
ccgctataccggctgcacaacttcctcattgtggagaccacagcgggtggaatcagccgg
caggaggcggtatccatgatcccgccgattgtcatggatgtacgacccacggacaaagtt
ctggacatgtgtgccgcgccaggttcgaagacagcccagctcatagaggctcttcacgct
gctcccgaagagcacaagattccgcccggctttgtcctggccaacgatgtggataacaac
cgctgctacatgctggttcaccaggccaagcgccttaactcgccctgcctgttggtgacc
aaccacgacagcagtgtctttcccaatctcttgaccacaatgcctgacggctcaaaggcg
atccttaagtttgataagatcctgtgcgatgtaccctgctccggcgacggcacactgcgc
aagaatccagacatttggctcaagtggaacttggcgcaggcctacaaccttcacggcatc
cagtaccggattgtgcgccgaggcgctgaaatgctggaggttggcggtcgtctggtatac
tccacctgctcattgaatcctatcgagaacgaggcggtgctgcagcgcattatcaaggat
gctgacggtgccttagagctggtagatgcggggcacttggtgccaggtcttaaatacaag
ccaggcatgactgactggaaactggccactaaggaggtggaccagatctttaccaacttc
gatgaggtgcctgaaagcctgcacaccatcatacggcccggtatgttcccgctgccggcc
gacgagatggccaagatcgggttggacaagtgccttcgggtgttgccgcatcttcaggac
agcggcggcttctttgtagccgtattggagaagcggcgtcagctaagcttcgagaagaac
gatgtggtggagctagtgcagctaaacgagaaggccaagcagcctgcagctgagccgcaa
ttggatgaggagggcaagcctgtcgaggaaaagtccgtcccgtggggaccgcagcgaaaa
aagcgacgtttgcatggctacaaggaagatccgtatgtgttctttggtgaaaatgatcct
gactacgaggctatcaaggagttctaccagctgaacgaatcccttagccaacgatgcctt
ctaactcgctgcatcacggagaaaaagaagaacatctattactgctccgaccccatccgc
gatttggtgctcaacaacgaaaacaacatcaaaatcattaacacgggcgttaagacattc
gtgcgctgcgagaacaggcacacggtgcatccctttcgattggcccaggagggtctccag
acctccaatgcattcatgggcgccaacaggagaatccaagtggagcgggaggacctggtg
atgatgcttaattgcaccgatcccacgcagccaccgtcgactcacgaactgaagaaggaa
actcaggagcgttgcaaggaattgggagtgggcagctgcatcctcaagtacgtggacgag
cggtttacgttgtacacggtgggctggcgcggcacctccagtctgcgcgcctatgtccac
aaggacgaaaccatccacattctgcggctgctgggctctgatcttagcaagtttgagacc
aacaagtacgaggacgcgagagtggcggctgctgctgcagcagacgctgaagccggcaag
agtggtgaggccgaagctggttcctcgggcgagggtgccgccacggagtccacatccatc
agtggagctgttgatgttccagaggccgccaagacaacaagcacacccatggacaccgaa
gaggtgaccacgagaagttag

DBGET integrated database retrieval system