KEGG   Drosophila yakuba: Dyak_GE17493Help
Entry
Dyak_GE17493      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
Organism
dya  Drosophila yakuba
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 6525372
NCBI-ProteinID: XP_002101208
FlyBase: FBpp0262503 FBgn0234956
UniProt: B4Q0P5
Position
X
AA seq 555 aa AA seqDB search
MSRRVDNKGKPVTAMLQVQAVHRDKTQVVELKKTTYLPYLFNLVLPKMFYQSTNRIVMAR
LYPDVHEHDKQAAEYFEGFQTPCFEMPASLFPGEVPMDKFVFMPTVMLPMGFEAGGVFGP
GVLPRRSYPIDLMASGHKGPTPPLFVGLSSLYVKLNSESESCLGNGGDQPASNVALVYAT
HPCKHTPKDSKELMHSNDYSLSIAYNLPVPPTPPSPYPLRPAPVQYNIYTPDLSNVHMLM
LRQRNLTVALLSTVNHPHVPAVAFATMGDEECPKFELPSDVFPICEGANRPIFLPMRFLP
KGFDAGCIFKPASLSELWFVNHIGRYGTPQPQLNCAITPPLFVGKYRRGTKAVKILKEIQ
MECERKFSQSAQSMEEASLQADEPKTPTTQGFMVMETEQQTPPKGAYCLESYQEASDTGC
VVKVTKEEATEAADTQEKNELHPINVETEPEDRGEAEDRKKYLSCFKVDSDIDLITEAMA
DMGTAEMRLLAKEEALPGVDCARALDQLRQVLEGRGQIRSQADQLIQDHIYRMDRNRMLA
LRQPIRMCSGCGMLH
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagccgacgcgtagacaacaagggaaagccggtgactgcaatgctgcaagtgcaggcg
gtgcatcgcgataaaacccaggtggtggagctgaagaagaccacgtacttgccctatctg
ttcaacctggtcttgccgaagatgttctaccagagcaccaaccgcattgtaatggcccgg
ctctatcccgatgtccatgagcacgacaagcaggcagccgaatacttcgagggcttccag
acgccctgcttcgagatgcccgcttccctgttcccgggtgaggtaccgatggacaagttc
gtcttcatgcccacggtcatgttgcccatgggcttcgaagccggcggggtatttggccct
ggtgttcttccacggcgttcctatcccatcgacctgatggcctctggtcacaagggtcca
acgccgccgctgttcgtcggtctgagcagcctgtatgtcaagctgaattcggagtccgag
agttgtctgggcaacggtggcgatcagccggccagcaatgtcgcactggtctatgcgacg
catccttgcaagcacactccaaaagactccaaggaactgatgcatagcaatgattactcc
ttgtcgatagcatacaacttgccggttccaccgactccaccgtcgccctatccattgcgt
cctgccccggtgcagtacaacatttacaccccggatctgtccaatgtccacatgctcatg
ctgcggcagcgcaacctgacggtggccttactgtccaccgtaaaccatccgcatgttccc
gccgtggcattcgccaccatgggcgatgaggagtgccccaagttcgagctgcccagcgat
gtcttccccatctgtgagggcgccaatcgccccatctttctgcccatgcgtttcttgccc
aagggattcgatgccggctgcatcttcaagccggccagtctttcggagctgtggttcgtc
aaccacataggtcgatacggcactccacagccgcagctcaactgtgccatcacaccacca
ctgttcgtgggcaagtaccgccgcggcacgaaggccgtcaaaattctgaaggaaatccag
atggagtgcgaaaggaaattttcccaaagtgctcagtccatggaagaggcatcgcttcaa
gctgacgagcctaagacgcccactacccagggcttcatggtaatggaaacggagcagcag
acacctccaaagggtgcttactgcttggagagctaccaggaggccagtgacacgggatgc
gttgtgaaggtcaccaaggaagaggccaccgaagccgctgacactcaagaaaagaatgag
ttacatcccattaatgtggaaacggaaccggaggacagaggcgaagcggaggacaggaag
aagtacctctcgtgcttcaaagttgatagcgacattgatctgataaccgaggccatggcc
gacatgggcaccgccgagatgagactgttggccaaggaggaggcactgcccggagtcgat
tgtgcacgcgccttggatcagctgcgccaggtgctcgagggtcgcggccagatccgcagc
caggccgaccagctgatccaggatcacatctacagaatggatcgcaatcgcatgctggcc
ctccgccagccgattcgcatgtgctccggatgcggcatgctgcactag

DBGET integrated database retrieval system