KEGG   Drosophila yakuba: Dyak_GE18855
Entry
Dyak_GE18855      CDS       T01068                                 

Name
(GenBank) uncharacterized protein
  KO
K03927  carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
dya  Drosophila yakuba
Pathway
dya00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dyak_GE18855
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dyak_GE18855
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     Dyak_GE18855
    3.1.1.84  cocaine esterase
     Dyak_GE18855
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 DUF6116
Other DBs
NCBI-ProteinID: EDW88659
FlyBase: FBgn0236238
UniProt: B4NY57
Position
2L
AA seq 564 aa
MPRLFQLTCALFLISITFTTAVTFIGDDPVVELSLGKIQGDRMQSFRNRTFYAFRGIRYA
QAPVGQLRFANPLPETSWGDEVLQATADSLVCPQPGVVSYMSEDCLKINVFTKNFEEKLP
VMVYIHGGANILGSGHSSYEAGPQYLLDQDVVFVAFNYRLGALGFLSTNSSETKGNFGYL
DQVMALEWVRDHISHFGGNPEMVTIFGMSAGSMAVSLHLASPLSAGLFHRAILMSGSATN
HFDIDNLYWTRKLARELGCPMYDPTDVVECLRNESWARIVEVCKAWESYQLITMKWNYEI
DGHFLPSHPTELIAEGNFNKVPLLISYTANEFDYNAYVHLGNQHLLHDMGSNFVDYAPEL
FLYRQDANIGEQLKDFYLGGNTTEINAKNIEDFGRIFSDAYIGHGVHRLVQLARAFTPVY
YTRMDYVGDRSLTAPLNGDNKPVGVAHADDLQYVMPGYWYGTVMTENDTDVFMMERMTSW
FSHFAKTGTPLNSTDTWPPCNLTHLKMLYNGVETQVGAPGYSDRYLVWDELFPTAARSGG
AAGKLSLVVAIATGVACRLIGKLM
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgcctcgactttttcagttgacgtgtgctctttttttaatttcaataactttcaccacc
gctgtaactttcattggagatgatcccgttgtggagctctccttgggcaaaatccaagga
gataggatgcagagcttcaggaacaggaccttctacgcattccgaggcatacgatatgcg
caagcgccggtgggtcagcttaggttcgccaatccactgccggaaactagctggggtgac
gaggtgctccaggccacagccgattccctggtttgtccgcaaccaggagtggtttcgtat
atgtctgaagattgcctgaagataaacgttttcacgaagaacttcgaggagaaattacca
gtgatggtgtacattcatggcggagccaatatcctgggcagtggacacagcagctatgaa
gcaggacctcaatatctgctggatcaggacgtggttttcgttgccttcaactatcgcctt
ggagctctgggatttctgagcacaaatagcagtgagacgaagggcaacttcggttacctc
gaccaggtgatggccctggaatgggtgagggatcacatatcccacttcggtggtaatcca
gaaatggtgactatattcggaatgagcgctggctcgatggcagtcagtctgcacttggcc
tcgcccctctccgctggtctcttccatcgggcaatcctcatgagcggctcggccaccaat
cactttgatatagataacctctactggacacgtaaactggctcgtgagctgggctgtccc
atgtacgatcccacggatgtggtggagtgcctgcgaaatgagagttgggcacgcattgtg
gaggtgtgcaaggcatgggaaagctatcagcttattacaatgaagtggaactacgagatc
gatggacactttctgcccagccatcctacggaacttatcgccgagggaaacttcaacaag
gtgcccttgctaatcagctacacggccaatgaattcgactacaatgcttatgtgcatttg
ggaaaccagcacttgctacacgacatgggctcaaactttgtggactacgcaccggagttg
tttctctatcgccaggatgcaaacattggagaacaactgaaggatttctatctgggtggc
aatactacagaaatcaatgcgaaaaacattgaggacttcggacgcatcttctctgatgca
tacattggacatggtgtccatcgccttgtccaactggccagagcctttaccccagtctat
tatacgcgtatggattacgtgggcgatcgaagtctcacggctccgctgaatggcgacaat
aagcccgtgggcgtggctcacgcggatgatctgcagtatgtgatgccggggtattggtat
ggcaccgtgatgaccgaaaacgatacggatgtttttatgatggagcgcatgaccagctgg
tttagccactttgccaaaacggggacacccctaaacagcacggatacgtggccaccctgc
aacttgacgcacttgaagatgctctacaacggggtggagacccaggtgggtgcgcccggc
tactcggatcgatacctcgtctgggacgaactgtttcccacggccgcccggagcggaggc
gctgccgggaaactcagcttggttgtagccatcgccactggtgtggcctgccggctcatc
gggaaattaatgtag

DBGET integrated database retrieval system