KEGG   Drosophila yakuba: Dyak_GE18922
Entry
Dyak_GE18922      CDS       T01068                                 

Definition
(GenBank) uncharacterized protein
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
dya  Drosophila yakuba
Pathway
dya00190  Oxidative phosphorylation
dya00860  Porphyrin and chlorophyll metabolism
dya01100  Metabolic pathways
dya01240  Biosynthesis of cofactors
Module
dya_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dyak_GE18922
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE18922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dya01006]
    Dyak_GE18922
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dya03029]
    Dyak_GE18922
Enzymes [BR:dya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     Dyak_GE18922
Prenyltransferases [BR:dya01006]
 Compound prenylation
  Protoheme farnesyltransferase
   Dyak_GE18922
Mitochondrial biogenesis [BR:dya03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    Dyak_GE18922
SSDB
Motif
Pfam: UbiA Oxidored_q2
Other DBs
NCBI-ProteinID: EDW88796
FlyBase: FBgn0236296
UniProt: B4NZA1
Position
2L
AA seq 391 aa
MILFKGMRRVQSQLRTPVELVLIRYSTAATISSQDDRGVTLAPPVSHPGKVQHLPDSQIT
WMPSPYTMPGKTFSQYKKLSKFRLTSLVVITTMGGYAMAPAAFDPTTFAMCTLGTGLVSA
AANAINQYHEVPFDSQMSRTKNRVLVTGQMTPLHAVTFAAASATAGLSMLYFGVNGLTAA
LGAGNLFLYTTIYTPMKRISIVNTWVGSIVGAIPPLMGWAGCAGTLDAGAMILAGILYAW
QFPHFNALSWNLRPDYSRAGYRMMAVTNPGLCRRTALRYSVAIAGLSAMAPVLDVTNYWF
ALETLPLNAYFAYLAYKFYEKSDSGSSRKLFRFSLIHLPALMLLFLANKKEWYFSKPAGE
ENKKESTYNAIKQSASSLGNVLPVAVAEGPR
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgatattattcaaaggaatgcggcgggtgcaatcccagctaagaaccccggttgaattg
gtgctcattcggtactccactgctgcaacgatatcttcccaagatgacagaggtgtcact
ctagcgccaccagtatcccatccgggaaaggtccagcatttacccgatagtcaaattacc
tggatgcccagtccgtacaccatgcccgggaaaaccttcagccagtacaagaagctttct
aagttccggctgacatcgctggtggtcattacaacgatggggggctatgccatggcaccg
gccgctttcgatcccaccacgtttgcgatgtgcaccctgggcactggactcgtttcggct
gcggcgaatgccattaatcagtatcacgaagttcctttcgattcgcagatgtcgaggaca
aagaaccgggtgcttgtcacgggacaaatgacgcctctgcatgccgtcaccttcgctgcg
gcatcggcaactgccggcttgagtatgctgtatttcggagtgaatggattgacggcggcg
ctgggagcgggtaacctgttcctctacaccacgatatacacgccaatgaagcgtatcagc
atagtcaacacctgggtgggttcgatagtgggcgccattcctccgctgatgggctgggct
ggatgtgccggcacactggatgccggcgccatgatcctagccggaatcttgtacgcgtgg
cagttcccgcacttcaatgctctgtcgtggaacctccgaccggactactcccgtgccggg
taccgaatgatggctgttaccaatccgggtctttgtcgccgcactgccctgcgatattcg
gtggcgattgccggactctcagcgatggcacccgtactggacgtcacgaactattggttt
gctttggaaactctacctctgaacgcgtacttcgcataccttgcgtacaagttttatgaa
aaatccgatagtgggagctcgcggaagctgttccgattctcactgatacacctgcccgcc
ctgatgctgctgtttctggccaataagaaagaatggtatttcagcaaacccgccggtgag
gaaaacaaaaaggaatccacgtacaatgcgataaagcagtctgctagcagtcttggtaat
gtccttcccgtcgccgtagccgaaggacccagatag

DBGET integrated database retrieval system