KEGG   Drosophila yakuba: Dyak_GE19532Help
Entry
Dyak_GE19532      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K09585  thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dyak_GE19532
Chaperones and folding catalysts [BR:dya03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dyak_GE19532
Membrane trafficking [BR:dya04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dyak_GE19532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Calsequestrin Thioredoxin_9 Arteri_Gl Thioredoxin_7 AhpC-TSA TraF Glutaredoxin Thioredoxin_3 OST3_OST6
Motif
Other DBs
NCBI-GeneID: 6535092
NCBI-ProteinID: XP_002095756
FlyBase: FBpp0264542 FBgn0236873
UniProt: B4PHN0
Position
3L
AA seq 430 aa AA seqDB search
MSPNSMWTFGLISALLLTLGSAGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTE
PIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDEL
VDYALRMSGPPVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFY
ATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLF
PKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFG
WIGEPSIAHSIILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIA
YGGDTYFVRLNRALFEVRRALRDMWLGNPVLTTVIFGLPLGFLSLIMYSIFCGDCLVTEE
DPDEDHEKKE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaattctatgtggaccttcggcctcataagtgctctgcttttgaccttgggt
tcggcggggctatcctcgaaggttttggaactcagtgaccgctttatcgatgtccgacac
gagggccaatggttggtcatgttctatgccccgtggtgcggctactgcaagaaaacggag
cccattttcgctctggtggctcaggcgctgcatgccaccaacgttcgagtgggtcgcctt
gattgtaccaagtatccggcggcagcaaaggagttcaaggttcgtggttatccgaccatc
atgttcatcaaaggcaacatggagttcacctacaacggagaccgtggtcgtgatgagttg
gtggattatgccttgaggatgtcaggtcctccagttcagctggtcacgcgaactgagagt
gtggacatgcttaagggatcccatacgatatttttcatattcgtgggccaacaggagggc
gtggtgtgggatacatactatgctgcggctgaaggttaccaggagcatggatttttctat
gccaccagcgaagatattgctgcccagcactttgactttgagaaactgccagccgtgata
gtctacaaagaagagcagcaccacttttatccgcacgggcatttggcccacgaaatggac
cccaatgaagtaaacgaaaccgttttccagtgggtgaacgtggagaggttcacactcttt
ccaaaggtcactcggtttaacatccaccagttgctgaagaccaacaagtacttggttttg
gctgtggtacaggaggataagctcaatcaaatagctacgcatgagctggagtttcgggac
atggtggagggtgtgataagaaaacacagggcgcgatatcatgacaaattccagtttgga
tggattggcgagccatcaattgctcattctattatcttggatcagctgccaactcctcac
ttgatagcgattaattcgagcacccaacaccacttcatacccgaagatgatcccatgcaa
atgactccacaggctctgcatcttttcctagaatctatccgcaacgaaagtgcgattgcc
tatggaggagatacgtactttgtacgtttgaatcgggcgttgtttgaagtgcgaagagct
ctaagggatatgtggctgggaaatcccgtgttgaccactgttatcttcggcctgccactg
ggattcttgtcgctcatcatgtactccatattctgcggcgattgtttggtcacagaagaa
gatcccgatgaagatcacgagaagaaggagtaa

DBGET integrated database retrieval system