KEGG   Drosophila yakuba: Dyak_GE19977Help
Entry
Dyak_GE19977      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dya  Drosophila yakuba
Pathway
dya04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dyak_GE19977
Enzymes [BR:dya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dyak_GE19977
Chaperones and folding catalysts [BR:dya03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dyak_GE19977
Membrane trafficking [BR:dya04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dyak_GE19977
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dyak_GE19977
  Exosomal proteins of colorectal cancer cells
   Dyak_GE19977
  Exosomal proteins of bladder cancer cells
   Dyak_GE19977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 OST3_OST6 Calsequestrin AhpC-TSA Redoxin TraF ERp29_N Thioredoxin_4 Mn_catalase
Motif
Other DBs
NCBI-GeneID: 6534179
NCBI-ProteinID: XP_002094862
FlyBase: FBpp0264987 FBgn0237304
UniProt: B4PIY3
Position
3L
AA seq 496 aa AA seqDB search
MKFLICALFLAASYVAASAEAEIKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCK
ALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGAPVEYSGGR
QAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKAANALD
SFVFGVSSNADVIAKYEAESNGVILFKPFDDKKSVFEGELTEENLKKFAQVQSLPLIVEF
NHESASKIFGGSIKSHLLFFVSREAGHIEKYVDPLKEIAKQYRDDILFVTISSDEEDHTR
IFEFFGMNKEEVPTIRLIKLEEDMAKYKPESNDLSAETIEAFLKKFLDGKLKQHLLSQEL
PEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDI
VIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADAEP
VEETEEEEEAPKKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctgatctgtgcacttttcctggcggcgtcctacgtggccgcttccgccgag
gcggagatcaaagttgaggagggcgttctggtggcgaccgtggacaacttcaagcagctg
attgccgacaacgagttcgtgctggtcgagttctacgccccatggtgcggacactgcaag
gctctggctcccgagtacgccaaggctgcccagcagctggccgagaaggagtcgcccatc
aagcttgccaaggtcgatgccaccgtcgagggtgagctggccgagcagtacgccgtccgt
ggctaccccactctgaagttcttccgcagcggcgctcccgtggagtacagcggtggccgt
caggctgctgacatcattgcctgggtgaccaagaagaccggcccaccagccaaggatctg
accagcgtcgctgatgccgagcagttccttaaggacaacgagatcgccatcattggattc
ttcaaggatctggaatcggaggaggccaagaccttcaccaaggccgccaacgctctggac
tcgttcgtcttcggtgtgagcagcaatgctgatgtgattgccaagtacgaggctgagagc
aatggagtgattctgttcaagcccttcgacgacaagaagtccgtgttcgagggtgagctg
accgaggagaacctgaagaagttcgcccaggtgcaatctctgcccctgatcgttgaattc
aaccacgagtctgcttccaagatcttcggtggctccatcaagtcgcatctgctgttcttc
gtgtcccgggaagccggccacattgagaagtacgtcgatcccctgaaggagatcgccaag
cagtaccgcgacgacatcctgttcgtgaccatctcatccgacgaggaggaccacacccgc
atcttcgagttcttcggcatgaacaaggaggaggtgcccaccatccgtctgatcaagctg
gaagaggacatggccaagtacaagcccgaatcgaacgatctgtccgccgagaccatcgag
gccttcctcaagaagttcctggacggcaagctgaagcagcacctgctctcccaggaactg
cccgaggactgggacaagaaccccgttaaggtgctggtctccagcaactttgagagcgtt
gccctggacaagagcaagagcgtgctggttgagttctacgccccatggtgcggacactgc
aagcagctggcccccatctacgaccagctggccgagaagtacaaggacaatgaggacatt
gtcattgccaagatggactccaccgccaacgagctggagagcatcaagatctcgtccttc
cccacaatcaagtacttccgcaaggaggacaacaaggtcatcgacttcaacctggacagg
actctcgatgatttcgtcaagttcctcgatgccaacggtgaggtggccgatgccgagccc
gtcgaggagaccgaggaggaggaggaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system