KEGG   Drosophila yakuba: Dyak_GE20050Help
Entry
Dyak_GE20050      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
dya  Drosophila yakuba
Pathway
dya00564  Glycerophospholipid metabolism
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dyak_GE20050
Enzymes [BR:dya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     Dyak_GE20050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 6534042
NCBI-ProteinID: XP_002094728
FlyBase: FBpp0265060 FBgn0237375
UniProt: B4PHW5
Position
3L
AA seq 494 aa AA seqDB search
MPFANEQLNLVASEQLSKTETIKLRNQHIGQACQLFYRSDPLKIVRGQGQYMFDEEGTRY
LDCINNVAHVGHCHPEVVRAGALQMATISTNNRFLHDELVQCARTLTSKMPEPLSVCFFV
NSGSEANDLALRLARNFTKRQDVITLDHAYHGHLQSVMEVSPYKFNQPGGEPKPDYVHVA
PCPDVYGGKFTDKMYPDADMGALYAQPIEEICQKQLAKGQGVAAFIAESLQSCGGQILPP
AGYFQAVYDAVRSAGGVCIADEVQVGFGRVGSHYWAFETQNVIPDIVCVAKPMGNGHPVG
AVVTTPEIAQAFHATGVAYFNTYGGNPVSCAIANAVMRVIDEEELQQKALVLGDYLLEEC
NRLKEDFECIGDVRGAGLFVGIELVQDRKERIPDKKAAHWVVNRMKQLHRVLVSSDGPND
NVIKLKPPMCFNRENADEFLLGFRECLTAVMQDRLASATTAAMAATSGVIATASETLANK
TKLFERQDRLIKSV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgccaacgagcaactgaatctggtggccagcgagcagctgagcaaaactgag
accatcaagctgcgcaaccagcacattgggcaagcctgccagctgttctatcgctctgac
cccctgaaaattgtgcgcggccaaggtcaatatatgttcgatgaggagggcacccggtat
ctggactgtatcaacaatgtggcccacgtgggtcactgccatccggaggtggtgcgagct
ggagccctgcagatggccaccatctcgacgaacaaccgctttctccacgacgaactggtg
cagtgtgctcgcacgttgaccagcaaaatgccggagccgctgtccgtttgcttcttcgtc
aattccggatccgaggccaatgacctggcccttcgactggcccgtaactttaccaagcgt
caggatgttatcactctcgaccatgcctatcatggtcatctgcagtccgtgatggaggtg
tctccatacaagttcaaccagcccggcggcgagccaaagcccgactacgtgcatgttgca
ccctgtccggacgtgtacggcggaaagttcacggacaagatgtatccggatgcggacatg
ggcgccctgtatgcccagcccattgaggagatctgccagaagcagttggccaagggccag
ggcgtggccgccttcatcgccgagagtctgcagagttgcggtggccagatcctgccacca
gccggctacttccaggctgtctacgatgccgtacgctcagccggaggtgtttgcattgct
gatgaggttcaggtgggctttggacgcgtgggcagtcattattgggcctttgagacccaa
aacgtaatccccgacatcgtgtgcgtggccaagcccatgggcaacggtcatccggtgggt
gcggtagttaccactccggaaatcgctcaggctttccatgccaccggcgtggcctacttc
aacacatatggcggcaatccggtttcctgtgccatcgccaatgccgtgatgcgcgtgatc
gacgaggaggaactgcagcagaaggcccttgtgctgggtgattatctgttggaggagtgc
aatcgtctgaaggaggactttgagtgcattggcgatgtgcgtggcgctggactcttcgtg
ggcatcgaattggtgcaggatcgtaaggagcgcattcccgacaagaaggccgcccactgg
gtggtcaaccggatgaagcagctgcaccgggtgctcgtctcctccgatggtcccaacgat
aatgtgatcaagctaaagccgcccatgtgcttcaaccgggagaatgcggatgagttcctg
ctgggcttccgcgagtgcttgactgccgtgatgcaggatcgactggccagtgccacaacc
gccgccatggctgctaccagtggcgtcattgccaccgcctcggagaccctggccaacaag
acgaagctcttcgagcggcaggatcgcctcatcaagtccgtctga

DBGET integrated database retrieval system