KEGG   Drosophila yakuba: Dyak_GE20433Help
Entry
Dyak_GE20433      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
dya  Drosophila yakuba
Pathway
dya04120  Ubiquitin mediated proteolysis
Module
dya_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dyak_GE20433
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dyak_GE20433
Ubiquitin system [BR:dya04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     Dyak_GE20433
Chromosome and associated proteins [BR:dya03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    Dyak_GE20433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_8 TPR_2 ANAPC3 TPR_16 TPR_11 TPR_12 TPR_14 TPR_17 TPR_19 TPR_9 SRP_TPR_like HrpB1_HrpK ChAPs
Motif
Other DBs
NCBI-GeneID: 6533288
NCBI-ProteinID: XP_002094014
FlyBase: FBpp0265443 FBgn0237748
UniProt: B4PK46
Position
3L
AA seq 905 aa AA seqDB search
MMIQEPVQAAIWHCLNYYDFKDAVFLAERLCSEVESDETIFLLATSYFRSNQVHQAYWLL
KEKARRSPQCRFLQAKCAYELKKYAEAESVLISTGFADAKNCDELQRDFGDLACFAYQLM
AQICVRTERNKLAVSALRRALKLNPFMWHAFADLCLLGQDTDAATIFQIHSTDVFNTCQG
SSANANAMVLFGAEQQSQQHQERHSLITSLCNSNPNYILTTPVDQQQQNQQQVQQINQNQ
NHNSSLVTPINNNNNNNNLNSSISMLRGGLVQNSSMLAMLEDTPMGYPQDTAGQQQQHQQ
LYDMSSGTPFRKQFKYLSAISPPTPSFGIMPLTSPCTGNDGSFIGNHTPVMNISYSPMPQ
MLVEVNQEPKMMGKKLKTHVGGLINRKEGSLNKPAVFTQAGNITPRTPNNNNVGNNGNMN
VPPNPNAAVRRSSRLFSNSYSVKENNKSPNIANKFVQPRSPPRKTKSRMTKICLNNELIE
EKSHHLSEKRKEKVETITSSGANNNSGGRSAAEEAKVLLNNSLNNAQTMAHQLMGLKKQS
ADGLMALLRDLAEAYQLLSNFQCKAAIKQLETTIPKHHLNSSWVQSLIGLARYEMREYEA
AVAIFESIHKAEPCRLDYMEIYSSSLWHLQREVELSALAQDLINQDKTSPVTWCVSGNCF
SLQKEHETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEFEKAMDYFRAAVVRDPRHYNA
WYGIGTIYSKQEKYELAEIHYVKALKINPQNSVILVHIGAMQFYMKKKDLSLQTLNTAAT
LDPKNPLTRFHRGSIYFSLGMYDEALRELEELKEVVPKESVVFYLIGKIHKTLGNMDLAL
MHFSWATDLDPKGANNQIKDAFDSMAHPSCCPANTTALDVDLEPTSERSDDSTQAQQDGS
YDSDY
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaagagcccgtgcaggccgccatatggcattgcctgaactactacgacttc
aaggatgctgttttcctggcggagcgcctgtgctcagaagtggagagcgacgagacgata
ttcctgctggccaccagctacttccgatccaatcaggtgcaccaggcatactggctgctc
aaagagaaggcacgacgatcgccgcagtgccgcttcctgcaggccaaatgcgcctacgag
ctgaagaaatacgccgaagcggaaagcgttctgatctcgacgggattcgcggacgccaag
aactgcgatgaactgcagcgggacttcggggatttggcctgcttcgcctatcagttaatg
gcccagatatgcgtgaggaccgagcgaaataaactggccgtcagtgctttaaggcgggcc
ctcaagctgaacccattcatgtggcacgccttcgctgatctgtgcctgctgggccaggac
acagatgcggcgaccatattccagatccacagcacagatgtgttcaacacctgccaaggc
agcagcgccaatgccaatgcaatggtgctcttcggcgccgagcaacaaagtcagcagcat
caggagcgccactcgctgatcaccagcctatgcaactctaaccccaactacattctgacc
acgcccgtggatcagcagcaacagaatcagcagcaggtgcagcagatcaaccagaatcag
aaccacaacagcagcctggtgacgcccatcaacaataataataataataacaatctcaat
agctcgatcagcatgctgcgcggcggtttggtgcaaaactccagcatgctggcgatgctg
gaggatacacctatgggttatccgcaggacacggccggtcaacagcagcagcaccagcag
ctatacgacatgagcagcggcacaccattccgcaagcagttcaaatacctttcggccatc
tcaccgccgactccgagcttcggcattatgccattgactagtccctgcaccggcaacgat
ggttcctttatcggcaaccacacgcccgttatgaatattagctattcgccgatgccgcaa
atgctggtcgaggtcaaccaggagccgaagatgatgggcaaaaagctgaagacacatgtg
ggcggactcatcaatcgcaaggagggcagccttaataaacccgccgtctttacgcaagcc
ggtaacataacgccccgcaccccgaacaacaataatgtgggcaacaatggcaatatgaat
gtgccgcccaatccgaatgctgcagtgcgtcgcagttcgcggctgttcagcaattcgtat
tcggtgaaggagaacaataaatcgcccaacatagccaacaagttcgtgcagccacgttcg
ccgccccgcaaaaccaagtcacggatgaccaagatctgcctgaataacgaactgatcgag
gagaagtcccaccacctgtccgagaagcgcaaagagaaggtggagactattacctcctcg
ggagcgaataataacagcggtggacgcagtgccgccgaggaggccaaggttctgttgaac
aatagcttaaacaacgcccagacgatggcccaccagctgatgggactcaagaaacagtcg
gccgatggactgatggccctactgcgggatttggctgaagcctatcagctgctttcgaac
ttccagtgcaaggcggccatcaagcagctggagacgacgataccaaagcaccacctgaac
tccagctgggtgcagtcgcttatcggactggccaggtacgagatgcgcgagtatgaggcg
gcggtggcgatatttgaaagcatccacaaggcagagccatgtcgcttggactacatggaa
atatactcgtcatccctgtggcatctgcagcgtgaggtggagctctctgctctcgcccag
gatctaattaaccaggacaaaaccagcccggtgacctggtgtgtgtccggaaattgcttc
tccctgcaaaaggagcacgaaacagcgatcaagttcttcaagcgggctgtccaagtggat
ccagacttcgtctacagctacacactgctgggccatgaactcgtactcaccgaagaattt
gaaaaggcgatggactatttccgagccgcagtggttagagatccacggcattacaacgct
tggtacggcatcggcaccatatactccaagcaggagaagtatgagctggctgaaatccac
tatgtgaaggcactgaaaatcaatccgcaaaactcggtaattctcgtgcacatcggcgcc
atgcaattctacatgaagaagaaggatctgtcgctgcagacgctaaacacggccgccacg
ctggacccgaagaacccgcttacgcgattccatcgcggctccatctacttttctttgggc
atgtacgatgaggcgttgcgcgaactggaggagcttaaggaggtcgtgcccaaggagtcg
gtggtgttctatctgatcggcaaaatacacaagacgctcggcaacatggatctggcgcta
atgcacttcagctgggccaccgacctggatcccaagggtgccaacaatcaaatcaaagat
gccttcgactccatggcccatcccagctgctgtccggccaacactacggccctggacgtt
gatctggagcccacttcggagcgttccgatgactccacgcaggcgcagcaggacggaagc
tacgacagcgactactag

DBGET integrated database retrieval system