KEGG   Drosophila yakuba: Dyak_GE20711Help
Entry
Dyak_GE20711      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12567  titin [EC:2.7.11.1]
Organism
dya  Drosophila yakuba
Brite
KEGG Orthology (KO) [BR:dya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dya01001]
    Dyak_GE20711
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dya04131]
    Dyak_GE20711
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dya04812]
    Dyak_GE20711
   04147 Exosome [BR:dya04147]
    Dyak_GE20711
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dyak_GE20711
Protein kinases [BR:dya01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   Dyak_GE20711
Membrane trafficking [BR:dya04131]
 Others
  Actin-binding proteins
   Others
    Dyak_GE20711
Cytoskeleton proteins [BR:dya04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     Dyak_GE20711
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE20711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 6532767
NCBI-ProteinID: XP_002093509
FlyBase: FBpp0353940 FBgn0238015
UniProt: B4PGK3
Position
3L
AA seq 1447 aa AA seqDB search
MGNQPGKLHTHPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHD
GGSPITGYTVEHRRMGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDAS
ELSDPLTVTLQRNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFS
SRRTKIVNDNEASVLVIHQVALTDEGEIKCTATNRAGHVITKARLMVQAPPKIRLPRTYE
DGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEITNTEKNSLLKIDNVLRED
RGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGN
YIVEYFRVGWNVWLKAATTRALTTTLHDLIEGSEYKFRVKAENPYGLSEPSGESELLFIP
DPKRGITKPKSATRIAGDEKDKPKAGAGGVQVPPRRKTLSPPRPQADASTGMSPKQSPSV
KRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLSSADLANKPTTESSNPKLNLTLV
TTTLAPPDKSVPSPKAPKTPATSPLKLFNPKPSGAPKDRSPVQPKPQPLPTPPKENPNKA
SPNQKRSLSPPNKRQPAPLRKSPTPPEPIKITPALLRSAEPVQLGVNQNVRRFSGQALSP
ARNVPTLALAVASGVSAVIGEKLPTIEISAPPTPQEEEPPLPEPSPSPEPALKSQSNARR
FSRSADKHDDVHTSNEFMLVVFDKNSKVKDKDRQDSFELDLEDAIQPPPISISAPDLAFL
EFTNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQAAKARKTSRDKLVTPVPHQTPAN
LRKRLGSISEAERLSFERRTELRRQSADMVSISRKWDSRENVNELGNLTRIHTTGQLPLE
TRKDLLEPEPEEEHEDVEEEHLTESTADDSEDMDLDYDEDMDVDEEYPPQKKLQQQSSND
LGSDYTESTASSEQDSIEKFKMELLARTRSPSPRDLETYHPRTMGAGTFTPYRAPTPEQA
AVVLNRPVPLPSPDFVPKPILKRSSNEHVEQAVSPLPSPLSFGKEEPSITVPPTSTVAAS
NPSTLKMDLAKGIKSFFSRDKRSATEKNTEANEEISNPLEKTNAAAIAADLEVKRKAKEE
EELRRKEEERLMQEEAHAAVDHYSDLVKEVGSSHRYHTPLYLDRDELKRAAAKAAAETDE
EDVLTHAEELKKRRATGGSEDLFLAPPVVRERRLSISEREQLVHVRDAASSLAFHRSPEK
AESEQEHESQPSQQDEEPEYPTVLVVPPPKSKNKNESETESVMSEMVEARPDARGRTRLV
KVKRVIRRRVPSSTRSRDASLTRPVIPDVEGSQQTSLVLSVADRELLQKAATLAILQSEE
QAHEKVRSALSYCTDLVLFLVACYVYLFKDARLVLPILGLIIYRQLGEAVRGYMPGWLRR
RFTGDGS
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcagccgggaaagctgcacacgcatccacagggcggtcgccccaagaagaat
gtccactggaagtccgcagaacgaccctcaccgcctggccgacccatcctgacgccagtg
gcactgccggagcagcagccggacgtggtgaacctgcgctgggatcggccactccacgat
ggaggttcacccatcacaggctatactgtggagcaccggcgcatggggtcaccgcactgg
gtgagggccacgcccactcccgtggatcgctgcgatgtgtgcatcagtggactggagccg
ggttggcgttaccagtttcgatgctttgccgagaacattgtggggcgatccgatgccagc
gagctgtccgatccgctgacggtgacgctgcagcgaaatgccataaccgtgccccggttc
atcgatgaactggtggacacgaatgccgtggaagacgagcgaatcgagttccgcgtgcgt
atacttggcgaaccgccgccggagatcaactggttcaaggacggctacgagatcttcagc
agtcgccgcaccaagatcgtcaacgacaacgaggccagtgtcctggtgatccaccaagtg
gcgctgaccgacgagggcgaaataaaatgcacggccaccaatcgagcgggacatgtgatt
accaaggcaagattaatggtgcaggctcctcccaagatccgattaccccgcacctacgag
gatggactaattgttgaggcggacgaagtgctgcgcctcaaagtgggtgtggctggacag
ccaccgcccgctattacgtggctccatgagggcgaggtcatcgctccgggtggacgcttt
gagatcaccaacacggagaaaaactcgctgctcaagatcgacaatgtgcttcgagaagat
cgcggcgagtatatggtgaaggcatggaatcgtttgggtgaggacagtacctcctttctg
gttacagtgaccgccaggcccaatcccccgggtactcccaagttgaatatgtcctttggc
aagtcggctactctctcctggacggctccactcgacgacggaggctgtaagattggcaac
tacatagttgaatatttccgagtgggctggaacgtttggctcaaggcggccaccactcgg
gcactgaccaccacgcttcacgatctgatagagggatctgagtacaaatttcgggtgaag
gcagagaatccatatggcctgagcgaaccgtcgggcgaatcggagttgctcttcatcccg
gatcccaagcggggaatcaccaaaccgaaatcagctacaaggatagcaggagatgagaag
gacaaaccgaaggcaggagctggaggggtgcaggtgccaccacgcagaaagactttatcc
cctccacggcctcaagcggacgcctccacgggcatgtcacctaaacagtcgcccagtgtt
aagcggaaacccaagccgcagctcatagacaacgagcaactgacccacgaaatgtcctat
ggaacctcggatcatgctctaaagatggacgtacgcaagagtccctcgctgagtagcgct
gatttggctaataagccgacgacagagagttccaatccaaagcttaacctcacactggtg
accaccacactggcaccgccggataagtctgtaccatcccccaaagcacctaagacacca
gctacctctccgttgaaactcttcaatcctaaaccctcaggagcccctaaggataggtca
ccagtgcagccgaaaccacagccattaccgactccgcccaaggaaaatccaaataaagca
tcacctaaccagaagaggagcttaagtccacccaacaagaggcaaccagctcctctgcgc
aaaagtcccacgccacctgaacccatcaagattaccccagctctgttgaggagtgcggaa
cccgttcaactgggagtcaatcagaatgtcaggcggttttccggacaggccctaagcccg
gccagaaatgtgcctactctggcattggcagtggcttccggtgtgtcagctgtaattggt
gagaagctgcccaccattgaaatcagtgctccaccaacgccccaggaggaggaacctcca
ctaccagagcccagtccgtctccagaaccagctctaaagtcccaatccaacgccagacgg
ttctccaggtcagccgacaaacacgacgacgtccacaccagcaatgagttcatgctggtc
gtcttcgacaaaaatagcaaggtcaaggataaggacagacaagattcttttgagctggac
ctggaggacgccatccagccaccacccatttcgatttctgcgccggatctggccttccta
gagttcacaaacttgcacaccacctttccactgcgtcgctccgtcagctcgacggaactc
ttgtatgaaagggccatggccaggttctacgaggcagtggaactcgagcaggctgccaaa
gcccgcaagacgtcgcgggacaaactggtcactccggttccccaccaaacgcctgctaat
ctccgcaagcgtctgggttccatttctgaggctgaacgtttgtctttcgaaagaagaacc
gagctgcgacgtcaatcggcggatatggtgtccatttcacgaaaatgggattccagggaa
aacgtcaacgagttgggtaacctgacacgtatccataccactggacaattgccccttgag
acgcgaaaggatcttctggagccggaaccggaagaggaacatgaagatgtagaggaggaa
cacttaactgagagtacggctgatgatagcgaggatatggatctggattacgatgaggat
atggatgtggacgaagagtatccgccgcaaaagaagctgcagcagcagtccagcaacgac
cttggttcggattacacagagagcactgcatcctcggagcaggactccatcgagaagttc
aagatggaacttctggcgcgcactcgatcgcccagtccgcgggatctggagacctatcat
ccgcgtaccatgggtgctggaacctttacaccatacagggcccccactccggagcaggca
gccgttgtgctcaaccgtccggtgcctctgcccagtccagatttcgtgcccaagccgatc
cttaagagatcctccaatgagcatgtggagcaagctgtcagtcccctgccgagtcctttg
tcctttggcaaagaagaaccgtctatcacagtgcctccaacttcaactgtagcagccagc
aatcccagcaccctcaaaatggacctggctaagggaattaagtcctttttcagccgcgac
aagagatcagccaccgagaagaacacagaggccaacgaggagatatccaatccgctggaa
aagaccaatgctgctgccatcgcagcggacttggaagtcaagagaaaagcgaaggaggag
gaggaattgcgtcgcaaggaggaggagcgcctaatgcaggaggaggcccacgctgcagtg
gatcactacagcgatctggtgaaggaggtgggcagttctcacagataccatacgcctcta
tacctagaccgggatgaactgaagcgagcggctgctaaggcagcagcggaaaccgacgag
gaggacgtgctcacccatgcggaggaactgaagaagagacgtgccaccggtggtagcgaa
gacctgtttctggctcctccagtggtcagagagcgacgactctccatctcggagcgggag
caacttgtccatgtccgggatgcagctagtagtctggcattccaccgatcgcccgaaaag
gcagagtccgagcaggagcacgagtcgcagccatcgcaacaggacgaggaaccggagtac
cccactgtgctggtggtgcccccgccgaaatcaaagaacaagaacgaatctgagactgag
agcgtcatgagcgaaatggtggaggctcgtccggatgccagggggcggacgcgcttggta
aaggtgaagagggtgatcaggcgaagggtcccatcgagcactcgctcacgagacgcgtca
ctcaccagacctgtgattccggacgtggagggcagtcagcagacatcgttggtcctctcc
gtcgccgacagggaattgctgcagaaggcggccactctggccatcctccagtcggaggag
caggcacacgagaaggttcgctcggcactcagctactgcacggacctggtcctcttcctg
gtcgcctgctatgtgtacttgttcaaggacgcacgcctggtcctgcccattctgggcctc
atcatctacaggcagctgggcgaggcagtgaggggctatatgcccggatggctgcgccgt
aggttcaccggggatggtagctag

DBGET integrated database retrieval system