KEGG   Drosophila yakuba: Dyak_GE21102
Entry
Dyak_GE21102      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K14009  B-cell receptor-associated protein 31
Organism
dya  Drosophila yakuba
Pathway
dya04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dya00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dyak_GE21102
SSDB
Motif
Pfam: Bap31 Bap31_Bap29_C Spc7 Zip MIP-T3_C Occludin_ELL SID-1_RNA_chan HAUS4 DivIC
Other DBs
NCBI-GeneID: 6532289
NCBI-ProteinID: XP_002093049
FlyBase: FBpp0266112 FBgn0238381
UniProt: B4PCN8
Position
3L
AA seq 228 aa
MSLVWTLIAGFLYAEIALVLLLILPVASPYRWNRFFKSKFLAMLGQQAHIYYPLILGLLV
IFLLESIREMRKYSGLQESNEVHLNVEMQHSMKMFRAQRNFYITGFAIFLLLVIRRLVNL
ICNQANLLAQSEASMKQAQSATAAARSLMDDKKTEKAKEAGEDTTLIELNKLRERVQELT
SELNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKITIGGGGNKDD
NT seq 687 nt   +upstreamnt  +downstreamnt
atgagtttggtgtggactttgatcgccggatttctctatgcggaaatcgcactggtgctc
ctgctgatcttgccggtggccagtccctaccgctggaaccggttcttcaagtccaaattc
ctagcgatgctgggacagcaggcgcacatatactacccactgatccttggattgctggtc
attttcctgctggagtccatacgcgagatgaggaagtactcagggctgcaggagtccaac
gaggtgcacctgaacgtggagatgcagcacagcatgaagatgttccgtgcccagcgcaac
ttctacatcaccggattcgccattttcctgctgctggtcatccggcgattggtgaacctg
atctgcaaccaggccaatctcctggctcagagcgaggcctccatgaagcaggcacagagc
gccactgccgccgcacgctccctgatggatgacaagaagaccgagaaggccaaggaagcc
ggcgaggataccactctcatcgagctcaacaagctgcgcgagcgcgtccaggagctgacc
tctgaattgaaccgcgagaagaaggacaaggaggcggttaagtcgcaggcggagagcatc
aaccgcgagtacgaccgactcaccgaggagtacagcaagctgcagaagaagataaccatc
ggcggaggcggaaacaaggatgattaa

DBGET integrated database retrieval system