KEGG   Drosophila yakuba: Dyak_GE21143
Entry
Dyak_GE21143      CDS       T01068                                 
Name
(GenBank) uncharacterized protein, isoform B
  KO
K10615  E3 ubiquitin-protein ligase HERC4 [EC:2.3.2.26]
Organism
dya  Drosophila yakuba
Pathway
dya04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dya00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dyak_GE21143
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dya04121]
    Dyak_GE21143
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     Dyak_GE21143
Ubiquitin system [BR:dya04121]
 Ubiquitin ligases (E3)
  HECT type E3
   Dyak_GE21143
SSDB
Motif
Pfam: HECT RCC1 RCC1_2
Other DBs
NCBI-ProteinID: KRK00728
FlyBase: FBgn0238420
UniProt: A0A0R1DU99
Position
3L
AA seq 1062 aa
MASGKELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTANGK
VYACGSNDHSQLGHELPTKRPRMSPFLLIPELQDYVVIQISCGSRHSLALSEWGQVLSWG
DNDCGQLGHATDKEIVQLPKVVRQLVSKTVVQIACGNNHSLALTSCGELYSWGSNIYGQL
GVNSPKDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDE
ANRAYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRM
VMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVS
PSGSALLQSNDAKVSVVIRQIFSGGDQSIVTTTLFMEKVPPEDFRIYNPKSQILALTAEV
TKQCAQFKQGGQSDMDLLSSIELIFKSQACWNGSFLLDHDRHFGCSVRNHGLDLNAAQLA
FDNLRVVENESIKQVIWDNITKELVGSLVSSPADVESMRLYLLLPLYHEFVNSKHYKSLQ
VPFANAIFKLTENPRKVLIKWLAQTPAEYFERLVQNCLNVVVHIISFKMGLAAISPSVER
RQRLLPYNTELEVILKLMQTLCQINNSRDDRLNYQSFYWPDLSDYADVQQEFVKWIMVDT
ASEFNICNYSFIFDQSAKTALLQADQALQMHSAMANAATMAFSLINYGMPISQFIVLNVT
RDNLVQDSLRELQRYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFK
EYEESRLLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLVLYKKLLGKPVDLSDL
RQLSPPEANSMQSLLDYQGEDFKDVFDLTFEISRDVFGEAETKCLKANGNEIAVTQENKQ
EFVDLYVDFVFNKSVELHYTAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQD
NCEYREGYTSGDDTIKWFWEVIHDLSEAEKKSFLLYLTGSDRIPIQGMKALKLTIQPTPD
ERFLPVAHTCFNLLDLPRYKTKERLKFKLLQAIQQTQGFSLV
NT seq 3189 nt   +upstreamnt  +downstreamnt
atggcatctggcaaagagctctattgctgggggagcacatcgcatggccaattgggactt
ggcggaatcgaggatgaacagatcctcacacccagtcagataccctggacaccggacacc
gctgtacagcaggtcgcctgtggacaccggcacaccctctttctaaccgccaatgggaaa
gtatacgcttgcgggagcaacgaccactcccaactgggacacgaactgcccaccaaaagg
ccacgtatgtcgccatttctgcttataccggagctgcaagattacgtggtcatccagatc
tcctgcggcagccgccactcattggcgctttccgagtggggccaggtattgagctggggc
gacaacgactgcggccagctgggacatgccaccgacaaggagatcgtgcagctgcccaag
gttgtgcggcaactggtctccaagacggtggtgcagatcgcctgtggcaacaatcacagc
ctggctctgaccagttgtggcgagctgtattcgtggggttccaacatctacggccagctg
ggcgtgaactcccccaaggatctgacacactgcaactatccccttcggctaaccacgctg
ctgggaattccgctggccgcgattgcctgcggcggcaatcactcgttcctcatctccaag
tccggtgcggtgttcggatggggcaggaacaactgtggccagcttggactgaatgacgaa
gcgaaccgcgcctatcccacccagctgaaaacgctgcgcaccctgggcgttcgatttgtg
gcctgcggcgatgagttctctgtttttctgaccaacgagggaggagtgtttacctgtgga
gctggcgcttacgggcagttgggacatggctttagctcgaatgagatgctaccgcgaatg
gtaatggagctgatgggcagcaccatcactcaggtggcctgtggcaatcgccacactctc
gcgctcgttccatcgcgcggcagggtttatgccttcggcttgggtagctctgggcagctg
ggcacgaggagcaccaagagcttgatgctgccgcaggtggtcatcggtccttgggtgtcg
cccagcggatcagccctgttgcaatccaatgatgcaaaggtctcggtggtcattcggcag
attttctcaggtggggatcagtcaattgtgaccacaacattgtttatggagaaggtgccg
cccgaggatttcagaatctacaaccccaaatcccagatccttgccctaacagcagaagtc
actaagcaatgcgctcagttcaagcaaggcggtcaaagcgacatggatctcctgagctct
attgaactgatatttaagagtcaggcctgttggaatggttccttcctgttggatcacgac
agacactttggttgctcggttcgcaaccacggattggatctcaacgcagcccaattggca
ttcgacaatctgcgcgttgtggaaaacgaaagcattaagcaggtgatctgggacaatata
accaaggagctagttggttcgttggtgagctcaccggcggatgtggagagcatgcgatta
tatcttttactaccactttaccacgagttcgtcaactccaagcactacaagtcactgcag
gttccgtttgccaatgccatatttaagctaacggagaacccacgaaaagtgctgatcaag
tggctggcccaaactccggctgaatactttgagcgccttgtccagaactgcttaaatgtt
gtcgtccatattattagtttcaaaatgggcttggctgccattagtcccagcgtggaaaga
cgtcaaaggctcctgccatataacactgagctcgaggtcattcttaaactgatgcaaacg
ctctgccaaatcaacaactcgcgtgatgatcgcctaaactatcaaagcttttactggccc
gacctttcggattatgcagacgtgcagcaggagtttgtgaaatggatcatggtcgacact
gccagcgaattcaacatttgcaattattcattcattttcgaccagtctgctaagacagcg
ttgctccaagcggatcaggcgctgcagatgcactctgccatggccaatgcggctaccatg
gcattcagccttattaactacgggatgcccatctcgcagttcatcgtgcttaacgtgacg
cgggacaatctggtgcaggattcccttcgagagttgcagcgttactcgcagagtgatctc
aagaagccgctgaaaatcaagttccatggcgaggaggcggaggacgcgggtggcgtgcgc
aaagagttcttcatgttgctgctgaaggatctcctcgatcccaagtacggtatgttcaag
gagtacgaggagtcgcgcctgctctggtttgcagatctcaccttcgagacggagaacatg
tacttcctaattggcgtcctctgcggtctggccatctataactttaccatcatcaacttg
ccatttccgctggttctgtacaaaaagctgctgggcaagccagtggatctcagtgatctc
cgccagctttcccctccggaggccaactccatgcaatctctgctcgactaccagggcgag
gattttaaggatgtttttgatctgacttttgagatatcgcgggatgtatttggcgaggcg
gagacgaagtgccttaaggccaacggcaatgagatagccgtaacccaggaaaacaagcag
gagtttgtggatctgtatgtcgactttgtgttcaacaagtccgtcgagctgcattacact
gcgtttcacaagggctttatgaaggtgtgctctgggcgggtgattcacatattccagccg
gaggagttgatggccgtggtggtgggcaacgaggactacgactggcaggcgctgcaagac
aactgcgagtaccgtgagggctacacttcgggcgatgatacaatcaaatggttctgggag
gtcattcatgatctgtccgaggcggaaaaaaagagtttcctgctctatctaactggcagc
gatcgcattcccatccagggcatgaaggcccttaaactcaccattcaacccaccccggac
gaacgattcctgcccgtggcccacacctgcttcaatctgctggacctgccgcgctacaag
accaaggagcgcctcaagttcaagctgttgcaggccatccagcagacgcagggcttcagt
ttggtctga

DBGET integrated database retrieval system