KEGG   Drosophila yakuba: Dyak_GE21608Help
Entry
Dyak_GE21608      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
dya  Drosophila yakuba
Pathway
dya00900  Terpenoid backbone biosynthesis
dya01100  Metabolic pathways
Module
dya_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dyak_GE21608
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dya01006]
    Dyak_GE21608
Enzymes [BR:dya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Dyak_GE21608
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Dyak_GE21608
    2.5.1.29  geranylgeranyl diphosphate synthase
     Dyak_GE21608
Prenyltransferases [BR:dya01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Dyak_GE21608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 6533305
NCBI-ProteinID: XP_002094031
FlyBase: FBpp0266618 FBgn0238862
UniProt: B4PK63
Position
3L
AA seq 338 aa AA seqDB search
MEELNSILQKTKDKSTQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQ
IGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDH
PEATKVYTEQLLELHRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFST
NKEDYSKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDK
QVLHILRQRTHDIEVKKYCITLLEKLGSFQYTRKVLETLDAEARAEVARLGSNPYMDRLL
NKLLSWKTSDSASITQSNQINHNNVSRSSPNQNTLNCN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactgaacagcatattacagaagaccaaagataaatcaacgcaaaaggagcag
gatgagattctgctgcagcccttcacatacatacaacagattcctggcaaacaattccgc
tccgagttggccttggccttcaatcactggttgctcataccgggcgaaaagttggcgcag
atcggagacattgtgcagatgctgcacaattccagtttgctcattgatgatattgaagac
aattcgatccttcgcagaggtgtgcccgtggcgcattccatttacggcgtggccagcacc
ataaatgcggccaactatgcactgttcctggcgctggagaaggtgcagcagctggatcac
ccggaggccaccaaggtgtacaccgaacagttgctggagctgcatcgcggacagggcatg
gagatctattggcgcgacagcttcacgtgtccctcggagtcggattacaagctgatgact
gtgcgcaagactggcggcctcttcatgctggccattcgcctgatgcagctgttcagcacc
aacaaggaggactattcaaagttgacggctatattgggcctgtactttcagatacgcgac
gattactgcaatctgagtctgaaagagtacacggagaacaagagcttcgccgaggactta
acggagggcaagttcggcttcccggtaatccatgcggttcgcacccagaagcaggataaa
caggttttacacatattacgccagcgcacgcacgacattgaggtcaagaagtactgcatc
accttgctggaaaagctgggcagctttcagtatacacgcaaggttctggagacgcttgac
gcggaggcgcgtgcggaggtggcccgtctgggtagcaatccgtacatggaccgcctcctc
aacaagctgctgtcgtggaagacgagcgatagcgccagcatcacgcagtcgaaccagatc
aatcacaacaacgtctcacgcagcagccccaaccagaacacgctcaattgcaattag

DBGET integrated database retrieval system