KEGG   Drosophila yakuba: Dyak_GE21760Help
Entry
Dyak_GE21760      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dya  Drosophila yakuba
Pathway
dya00230  Purine metabolism
dya01100  Metabolic pathways
Module
dya_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dyak_GE21760
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dyak_GE21760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_16 AAA_18 ABC_tran MMR_HSR1 RsgA_GTPase AAA_29 RNA_helicase Mg_chelatase AAA_5 NACHT ATPase_2 AAA_21 AAA_17 AAA_14 AAA_28 Pox_A32 cobW Rad17 AAA_24 G-alpha AAA AFG1_ATPase Roc AAA_30 HGTP_anticodon2 MobB AAA_23
Motif
Other DBs
NCBI-GeneID: 6533613
NCBI-ProteinID: XP_002094321
FlyBase: FBpp0361442 FBgn0239005
UniProt: B4PEG7
Position
3L
AA seq 236 aa AA seqDB search
MISFLFIVNRALSSSSSGVSSSAATLTRSKKKMTAPGPRPLVLCGPSGSGKSTLLKRLFA
EFPNTFGFSISHTTRKPRAGEEHGVHYYFVERPEMEEAIAGDEFIETAEFTGNLYGTSKA
AVREIQAQGRVCILDIEQKGVEQIRRTDLNPILIFNNPPSIEELERRLRQRGSETEESLS
KRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQEKQGVSVSLK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgcgcgctcagcagcagcagcagcggcgtcagc
agcagtgcggcaaccttaacgagaagcaagaagaagatgaccgcccccgggccacgcccc
ctcgtcctatgcggaccctcgggctccggaaaaagtacgctgctgaagaggctatttgcg
gaattccccaacaccttcggcttcagcatatcgcacaccacgcggaagccacgcgctggc
gaggagcacggagtgcactactactttgtggaacggccggaaatggaggaggccatcgcc
ggcgacgagttcatcgagacggcggagtttacgggtaatctgtatggaacgagcaaggcg
gcggttagggaaatccaggcacagggacgcgtctgcatactggacatcgagcagaagggt
gtggagcagatacgtcgcacggatctcaatcccatactgatcttcaacaatccaccgagc
atcgaggagctggaacgacgactgcgtcaacgtggctccgaaacggaggagtcgctgagc
aagcgcctcaatgccgcccaggtggaactcgattatggtttgacgccgggcaacttccac
aagatcatcaacaatgtggacatcgatgtggcctacgaggagttccgcaactttgtcgtc
caggaactcaaggagcaggagaagcagggagtatccgttagcctgaagtaa

DBGET integrated database retrieval system