KEGG   Drosophila yakuba: Dyak_GE21811Help
Entry
Dyak_GE21811      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
dya  Drosophila yakuba
Pathway
dya00051  Fructose and mannose metabolism
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dyak_GE21811
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dya04147]
    Dyak_GE21811
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     Dyak_GE21811
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE21811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 6533707
NCBI-ProteinID: XP_002094412
FlyBase: FBpp0266821 FBgn0239056
UniProt: B4PF42
Position
3L
AA seq 322 aa AA seqDB search
MTKYGNKLSWAVGKKTVLCIGTTTIDFVSTIKHFPGENTHQQVIGGYWIRGGKASNNCTV
LANLGVKVELLGVLSNWSVFQVLIDDLRARGIIIENCPRCDQGAPFSSVILCKATKTRNI
VYCNNNFPYVSIEDFRKLDLNRYGWIHIRALYFDKSLPMVKDIEAYNATSKEKIVLSIYF
DNNLDDMWPLMDYCDYAVFSKKLAQTNGWTSMEDACLQLDERLRMRWGLNLKRPYVVVLW
GDQGAGFMDLDGNFTHAKPHKPRRIVDALGAGDTFMGTFIYALYIRERSLAVAVDFGNRM
ASYKCTRNGYDHIANILLPPIL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatatggcaacaaactgagctgggctgtgggcaagaagacggtgctgtgcatc
ggcaccacgaccattgactttgtctcgaccataaagcactttcccggagagaacacacat
caacaggttattggaggctactggattcgcggtggaaaggcatcgaacaactgcacagta
ctcgccaatctgggggtcaaagtggagctgctgggagtgctgagcaattggagtgtgttc
caagttctgatcgatgacttgcgagcacggggcatcattatcgagaactgtccgcgttgt
gaccagggtgcgcccttctcatccgtgatcctctgcaaggcgaccaaaacgcgaaacatt
gtctattgcaataataactttccgtacgtgagcatcgaggatttccggaagttggacctc
aaccgctatggttggatacacattcgtgccttgtactttgataaatcgctgccaatggtc
aaggacatagaggcttataatgcgaccagcaaggagaagatcgtgctatccatatatttt
gataacaacctggacgacatgtggcccctgatggactactgtgactatgccgtgttctcc
aagaagctggcccaaaccaatggctggacttccatggaggacgcctgcctgcagctggac
gagcgattgcgtatgcgttggggtctcaacctgaagcgaccatatgtggtcgttttgtgg
ggcgatcaaggtgccggattcatggatctcgatggcaacttcacccacgccaagccccac
aagcccagacgcatcgtggacgccttgggcgccggagacaccttcatgggcaccttcatc
tacgccctctacatccgggagagatcccttgccgttgccgtggacttcggcaatcgcatg
gccagctacaagtgcacgagaaatggatacgatcacatcgctaatatcttactgccgccg
atcttgtga

DBGET integrated database retrieval system