KEGG   Drosophila yakuba: Dyak_GE22212Help
Entry
Dyak_GE22212      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dya  Drosophila yakuba
Pathway
dya00010  Glycolysis / Gluconeogenesis
dya00562  Inositol phosphate metabolism
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE22212
   00562 Inositol phosphate metabolism
    Dyak_GE22212
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dyak_GE22212
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dyak_GE22212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 6534444
NCBI-ProteinID: XP_002095121
FlyBase: FBpp0267222 FBgn0239439
UniProt: B4PKD5
Position
3L
AA seq 467 aa AA seqDB search
MRLLILLLLPLVAIAQDDYCFSKDTSRLQTRQFSSKTAYQIVKGTDIDKQYLVPGCQPQK
MWIFHRHGTRLPKKSMIKKATRVAELRDLIIKNYQVARTKPDTDALCQTDLIAIKLWKWN
SSITPDMEEYLTAQGYEDLRGTAKLYQRYYPSVLPPTYNDTYYQFRHTDTQRTTESFKAF
AEGLFGSQNDAHPVEIPKQDLLLRPYDYCSSFKNVNYKDEGSEYYKFHQSKLYNDTLVDI
STRLGFLYTLEEADIKLMYDMCRYEQAWNVDRNSVWCGAFLPEQVTVFEYLEDLKYYYGS
GYGFPENAHLNCRLVQDLLTHLSNPVSPHVVAHFGHSTGLLTLITALGIQKDDIKLRADN
YDSLTSRRWKSSLIDPFASNFVAVKYDCPADLDREKVVFFLNQQAVQLDWCSVGLCKWSD
VLEKYKTIADADCVEYYCRAGGAPSLGSGVTGLLATTLAAMLVYLMH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgctgattttgctactgctgccactggtggccatcgcccaagatgactactgc
ttcagcaaggacacctcccgcctccagacccgccagttctcctcgaagaccgcctaccag
atcgtcaagggcacggacatcgacaaacagtacctggtgcccggctgccagccccagaag
atgtggatcttccacaggcacggcacacggctgcccaagaagagcatgatcaaaaaggcc
accagggtggccgagctgcgcgatctcatcataaagaactatcaagtggccaggaccaag
cccgatacggatgccctgtgccagacggacttgattgccatcaagctgtggaagtggaac
agcagcataacgcccgacatggaggagtatctgaccgcccagggttacgaggatctcagg
ggcacggccaagctgtaccagcgctactaccccagtgtgctgcccccaacttataacgat
acctattaccagttccgtcacacggacacccagcgcaccacagaaagcttcaaggctttt
gccgagggtctcttcggttcccaaaacgacgctcatcccgtcgagattcccaagcaggac
ctgctgctgcgtccttatgactattgctcatccttcaagaacgtgaactataaggatgag
ggctctgagtactacaagtttcatcagtctaagctgtacaacgacaccttggtagatatc
tccactcgcttgggtttcctttacaccctggaggaagcggacatcaagctaatgtacgac
atgtgccgctatgagcaagcgtggaatgtggatcgcaacagcgtctggtgcggcgctttc
ctgccggagcaagtaacggtctttgagtacctggaggatctaaagtactactacggatcg
gggtatggattcccggaaaacgcgcatctcaactgccgactggtgcaggacctgctcacg
cacctaagcaacccggtgtcgccacatgtggtggctcactttggccactcgacgggcctg
ctgaccctgattactgcgctgggaatccagaaggacgatatcaagttgagggcggacaac
tacgatagcctgacgagccgccgttggaagagcagcctgatcgatccgtttgcctccaat
ttcgtggcggtgaagtacgactgtccggcggacttggatcgcgagaaggtggtcttcttc
ctcaaccagcaggctgtgcagctggactggtgcagtgtgggtctgtgcaagtggtccgat
gtccttgagaagtacaagaccattgcggacgcggactgcgtggaatactactgccgggcg
ggaggtgctccatcgctgggatccggagttaccgggcttctggccaccacgctcgccgcc
atgctggtctacttaatgcactaa

DBGET integrated database retrieval system