KEGG   Drosophila yakuba: Dyak_GE22745
Entry
Dyak_GE22745      CDS       T01068                                 
Name
(GenBank) uncharacterized protein
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
dya  Drosophila yakuba
Pathway
dya00785  Lipoic acid metabolism
dya01100  Metabolic pathways
dya01240  Biosynthesis of cofactors
Module
dya_M00882  Lipoic acid biosynthesis, eukaryotes, octanoyl-ACP => dihydrolipoyl-H
dya_M00883  Lipoic acid biosynthesis, animals and bacteria, octanoyl-ACP => dihydrolipoyl-H => dihydrolipoyl-E2
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Dyak_GE22745
Enzymes [BR:dya01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Dyak_GE22745
SSDB
Motif
Pfam: LIAS_N Radical_SAM
Other DBs
NCBI-ProteinID: EDX00027
FlyBase: FBgn0239951
UniProt: B4IUG3
Position
3L
AA seq 379 aa
MFGMLRALKTHVEAPIVVATRAASTNAEKLEEIRERLAKGPNFQDFVQNPDNSRSEWENY
EGKLRREKGEEQRLRLPPWLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGG
GEHGTQTATIMLMGDTCTRGCRFCSVKTARKPPPLDVNEPVNTATAIASWGLDYIVLTSV
DRDDLPDGGSKHIAETVREIKARNSNIFVECLVPDFRGNLECVETIANSGLDVYAHNIET
VEKLTPYVRDRRAHYRQTLQVLTEAKRFNPNLITKSSIMLGLGETDEEIESTLKDLRTAG
VDCVTLGQYMQPTNKHLKVIEYVTPEKFKHWEERGNELGFLYTASGPLVRSSYKAGEFFI
TSILENRKKRQNATELSKE
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtttggcatgttgcgagctttaaaaactcacgtggaggcccccatagtagttgccaca
cgtgcggcatcaacaaatgcggaaaagctcgaggaaattcgggaacgtttggcgaagggt
ccgaatttccaggactttgtccagaatccggataactccagaagcgagtgggagaattac
gagggaaagcttcgtcgcgaaaagggcgaggagcagcgcctgcgactgccgccgtggttg
aagaccaccatacccgtgggcaagaactacgccaagatcaaggcccagatgcgcgagctc
aagctgtcaaccgtctgcgaggaggctcggtgtcccaacatcggcgagtgctggggcggc
ggcgagcatggcacccagacagccacgattatgcttatgggcgacacttgcaccagaggc
tgtcgattttgttcggttaaaacggctcgcaaacctccaccgctggatgtaaatgaaccc
gtgaacacagccaccgcaattgcttcctggggattggattacattgttctcacctcagtt
gatcgcgatgatctgccagacggcggctcgaagcacattgccgaaactgttcgcgaaata
aaggcgcgcaactcaaacatctttgtggagtgcctggtaccagatttccgaggcaatcta
gagtgtgtcgagacgatcgccaacagcggcctagatgtttatgcgcacaacatagagacg
gtagagaagctcacaccctatgtgcgagataggcgtgctcactaccgccagaccctgcaa
gtgctaaccgaagcgaagcgattcaatcccaatctcatcactaagagttccattatgctg
ggtcttggtgagaccgatgaggagattgaaagcaccttgaaggatctgcggacggccgga
gtcgattgcgtgaccttgggtcagtacatgcagcccacaaataagcacctcaaggtcatc
gagtacgtcacgcccgagaagttcaagcactgggaagagcgcggtaacgaattgggtttc
ctgtacacagccagtggaccgctggttcgcagctcctacaaagccggcgagttcttcatt
actagtatattggagaaccgcaagaagaggcaaaacgccactgaactttccaaggagtag

DBGET integrated database retrieval system