KEGG   Drosophila yakuba: Dyak_GE23365Help
Entry
Dyak_GE23365      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dya  Drosophila yakuba
Pathway
dya04140  Autophagy - animal
dya04213  Longevity regulating pathway - multiple species
dya04310  Wnt signaling pathway
dya04341  Hedgehog signaling pathway - fly
Module
dya_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dyak_GE23365
   04341 Hedgehog signaling pathway - fly
    Dyak_GE23365
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dyak_GE23365
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dyak_GE23365
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dyak_GE23365
Protein kinases [BR:dya01001]
 Serine/threonine kinases: AGC group
  PKA family
   Dyak_GE23365
Messenger RNA biogenesis [BR:dya03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dyak_GE23365
Chromosome and associated proteins [BR:dya03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dyak_GE23365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 6538925
NCBI-ProteinID: XP_002099429
FlyBase: FBpp0268375 FBgn0240558
UniProt: B4PMK7
Position
3R
AA seq 354 aa AA seqDB search
MSQHTTQYVFNSKEDYNITLDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVM
LVREKGGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYL
ILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHRMHLMYRDLKPENILLDQRG
YIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPF
AIHNRDVILMYSKICVCDYKMPSYFTAQLRSLIESLMQVDTTKRLGNSNEGASDVKGHPW
FQGVDWFGILNQEVTAPYLPTVSGAEDLSNFENFEFKDRYKSRINRHPELFANF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcacactacgcagtacgttttcaactcaaaggaagactacaacatcacccta
gacaacatgagtcgcgagttcgaagagcggtggaaccaccagacccagtcgccctacacc
aacctggagaactatataaccagggccgttctcggcaacggaagttttggcactgtgatg
ctggtcagggagaagggtggcaagaactactatgccgccaagatgatgagcaaggaggat
ctggtgcggctgaagcaggtggcccacgtacacaacgagaagcacgtcctgaatgccgcc
cgattcccgttcctcatctacctggtggactcgacgaagtgctttgactacctctacctg
atcctcccgctggtcaatggaggtgagctgttcagctaccatcgcagagttcgcaagttc
aacgagaagcatgccagattctatgccgcccaggtggcactggccctcgagtatatgcac
aggatgcacctcatgtaccgtgatctgaagccggagaacattctgctcgatcagcgcggc
tacatcaaaatcacggactttggtttcacaaagcgtgtggatggccgcacctcaacgctg
tgtggaaccccggagtacctggccccggagatcgttcaactccggccgtataacaaatcg
gtggactggtgggccttcggtatcctggtgtacgagtttgtggcagggcgctctcccttc
gccattcacaatcgagatgttattctgatgtactccaagatctgcgtgtgcgactacaag
atgccctcatactttacggcccagctgaggagtctcatcgagagtctcatgcaggtggac
accaccaagcgtttaggaaactcgaacgagggcgccagtgacgtgaagggtcatccgtgg
ttccagggcgtggattggtttggcattcttaaccaggaggtcaccgccccctacttgcca
actgtttccggtgccgaagatctgtccaactttgagaacttcgagttcaaggatcggtac
aagtcccgaataaaccgccatcccgaattgtttgcgaatttttaa

DBGET integrated database retrieval system