KEGG   Drosophila yakuba: Dyak_GE23412Help
Entry
Dyak_GE23412      CDS       T01068                                 

Gene name
Dyak_Tpi
Definition
(RefSeq) Tpi, isoform A
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dya  Drosophila yakuba
Pathway
dya00010  Glycolysis / Gluconeogenesis
dya00051  Fructose and mannose metabolism
dya00562  Inositol phosphate metabolism
dya01100  Metabolic pathways
dya01200  Carbon metabolism
dya01230  Biosynthesis of amino acids
Module
dya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dya_M00002  Glycolysis, core module involving three-carbon compounds
dya_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE23412 (Dyak_Tpi)
   00051 Fructose and mannose metabolism
    Dyak_GE23412 (Dyak_Tpi)
   00562 Inositol phosphate metabolism
    Dyak_GE23412 (Dyak_Tpi)
Enzymes [BR:dya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dyak_GE23412 (Dyak_Tpi)
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dyak_GE23412 (Dyak_Tpi)
  Exosomal proteins of bladder cancer cells
   Dyak_GE23412 (Dyak_Tpi)
  Exosomal proteins of melanoma cells
   Dyak_GE23412 (Dyak_Tpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 6538841
NCBI-ProteinID: XP_002099354
FlyBase: FBpp0268422 FBgn0025012
UniProt: B4PLS9
Position
3R
AA seq 350 aa AA seqDB search
MPPGVLPKLNRNGVQSISKALLFQRLPFHRSQHTIRTMDHNRPTVGGVTAEVLKTVVSQA
LLGKFTAVFPKLFKCQWKTYEGQKKFFANFSTDCTDSDSNSNNMSRKFCVGGNWKMNGDQ
KSIAEIAKTLSSAALDPNTEVVIGCPAIYLMYARNLLPCELGLAGQNAYKVAKGAFTGEI
SPAMLKDIGADWVILGHSERRAVFGESDALIAEKAEHALAEGLKVIACIGETLEEREAGK
TNEVVARQMCAYAQKIKDWKNVVVAYEPVWAIGTGKTATPDQAQEVHAFLRQWLSDNISK
EVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIINARQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaggagtgctccccaagctgaataggaacggtgtccagagcatttccaaagca
ttacttttccagcgcctcccatttcatcgcagccagcataccatccgcaccatggatcac
aaccgacccactgtgggtggtgtgacggcggaggtgctaaaaaccgtcgtttcgcaagct
ctgcttggcaaattcacagctgtttttccaaagctcttcaagtgccagtggaagacttac
gaaggtcaaaagaagttcttcgcaaatttcagcaccgattgcaccgacagcgacagcaac
agcaacaacatgagccgaaagttctgcgtgggaggcaactggaagatgaacggcgaccag
aagtccatcgccgagatcgccaagaccctcagctccgccgccctggaccccaacacggag
gtggtcatcggctgcccggccatctacttgatgtacgcccgcaacctgctgccctgcgaa
ctgggtctggccggccagaatgcctacaaggtggccaagggcgccttcaccggcgagatc
tcgccggctatgctgaaggacatcggcgccgactgggtgatccttggacactcggagcgt
cgcgccgtctttggcgagtcggacgccctgatcgccgagaaggccgagcacgccctggcc
gagggcctcaaggtcatcgcctgcattggtgagaccctggaggagcgcgaggccggcaag
accaacgaggtggtggcccgccagatgtgcgcctacgcccagaagatcaaggactggaag
aacgtggtggtggcctacgagcccgtctgggccattggcaccggcaagaccgccacaccc
gatcaggcacaagaagtgcacgccttcctgcgccagtggctgagcgacaacatctccaag
gaggtctccgccagcctgcgcatccagtacggtggatccgtgaccgccgccaacgccaag
gagctggccaagaagcccgacatcgatggcttcctcgtcggaggcgcctccctgaagccc
gagttcgtggacatcatcaatgcccgccagtaa

DBGET integrated database retrieval system