KEGG   Drosophila yakuba: Dyak_GE23421Help
Entry
Dyak_GE23421      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform G
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
dya  Drosophila yakuba
Pathway
dya00061  Fatty acid biosynthesis
dya00620  Pyruvate metabolism
dya00640  Propanoate metabolism
dya01100  Metabolic pathways
dya01212  Fatty acid metabolism
Module
dya_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dyak_GE23421
   00640 Propanoate metabolism
    Dyak_GE23421
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dyak_GE23421
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Dyak_GE23421
Enzymes [BR:dya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Dyak_GE23421
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Dyak_GE23421
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dyak_GE23421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp MetallophosN
Motif
Other DBs
NCBI-GeneID: 6528514
NCBI-ProteinID: XP_002089560
FlyBase: FBpp0362880 FBgn0240607
UniProt: B4P271
Position
2L
AA seq 2564 aa AA seqDB search
MLITILGTLAAFLAFLLTLIFGRGQKRLNLDQSSSATSATTATTGDSDNGNTNHNSSVIA
ATATATTTTSKPLTAPAAPPPAVKAGDKRFPKACIKKVKFSSESLRSEVEKLCDQLENSA
LTDLSNDNIRIACHQNNNSINKNQNNNNIDIKISKMSETNESNDTAAQSAEGERPSFLVG
DEIDEGAAEAGEACDEFPQKMQSDVRQNGDISERRKRLRMLKRRASKRFVLVESGENNTN
GSGSGSGVGTVSGAVIPQFVAVDCGQNENNNNNVGEMSASISNHNNANNQSSPSLLSVPV
VGTLKPSMSRGTGLGQDRHQDRDFHIATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRS
IRRWAYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDI
ALRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIP
TLPWSGSELKAQYSGKKIKISSELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGI
RRVDTAEEFPGLFRQVQAEVPGSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQ
RRHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEGRYFFLELNPR
LQVEHPCTEMVADVNLPAAQLQIGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRP
SGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCF
SWGENRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERV
QSEKPDILLGVMCGSLHIADREITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRY
KVQAAKSGANSYFLLMNNSFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQ
TCVFEKENDPSLLRSPSAGKLINMIVEDGAHVSKGQAYAEIEVMKMVMTLTSQEAGTVTF
VRRPGAVLDAGSLLGHLELDDPSLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILEN
TLAGYCLPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLM
TLYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGR
MKAAVHELLRQYYDVESQFQHGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVT
LLIDHLWANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMES
IFLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYE
LTCLQHLELSGGLSLVHFQFLLPTAHPNRLFSRMSSPDGLDQAAAESLGSSFVRTGAIAA
FDSFEHFEMYSDEILDLLEDFVSPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTR
ANAAEEAKSTEPIHIVSVAVRETGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALK
KRQFPKFFTFRARDKFAEDRIYRHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKA
KVSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKR
TDCNHIFLNFVPTVIMDPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQA
VRLCIANDSGYFLDISMYTEQTEPETGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKR
FQAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRTPDKILIECKELVLEGDNLVE
MQRLPGENNCGMVAWRIVLATPEYPNGREIIVIANDLTYLIGSFGIKEDVLFAKASQLAR
QLKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSV
RAILIEDEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGI
GSYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAI
DLDGVYTILDWLSYIPAYIGCDLPIILPSDRIDRPVDFMPTKSPYDPRWMLGGRVNPVNA
NDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSE
AKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYI
VDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIK
YKEKDLVKTIHRLDPTTIALKKEFDEANASGDKVRATQVDEKIKARIAVLIHVYHTVAVH
FADLHDTPERMLEKECISEIVPWRDSRRWLYWRLRRLLLEDAYIKKILRAQDNLSVGQAK
QMLRRWLVEEKGATEAYLWDKNEEMVSWYEEQSNAESIVSRNVNSVRRDAIISTISKMLE
DCPDVALDAVVGLCQGLTPVNRGVVVRTLAQMQLNEETSNSNQG
NT seq 7695 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcacgatattaggcactctggctgcttttctcgcattcctcttgacattgatc
tttggccgcggccagaaaagattgaatcttgaccaatcgtcttcagcaacatccgccacg
acagcaacaactggcgacagcgacaacggcaacaccaatcacaactccagcgtgattgca
gctacagctacagcaacaaccaccaccagcaaacctctcactgcacctgcagcacctccc
ccggcagttaaagcgggtgacaagcggtttcccaaggcctgcatcaagaaggtcaagttc
tccagcgagagccttcgttcggaagtggagaagctgtgtgaccagctggagaatagcgca
ctcaccgacctaagcaacgacaacatccgcattgcctgccaccaaaacaacaacagcatc
aacaagaaccaaaacaacaacaacatcgacatcaaaatcagcaagatgagcgaaacaaat
gagtccaatgacacggccgcccaatccgccgagggcgagcggcccagcttcttggtgggc
gatgagatcgacgagggggccgccgaggcgggcgaggcctgcgacgagtttccccagaag
atgcagagcgatgtccggcagaatggggatatttccgagcggcgcaagcggttaagaatg
ttgaagcgtcgcgccagcaagcgtttcgtacttgttgagtccggtgaaaataataccaat
ggatccggctctggatcgggagtgggtacggtctcaggtgcggttataccccaatttgtg
gcagtggattgcgggcagaacgagaacaacaacaacaatgtcggcgagatgagtgccagc
atcagcaatcacaataatgccaataaccagtcgtcgccatcgctgctcagcgtccccgtg
gtgggaaccctcaagccgagtatgtcgcgtggcactgggttgggccaggaccgacatcag
gatcgcgacttccacatcgccaccaccgaggagttcgtaaagcgcttcggcggtacccgt
gtgatcaacaaagtcctaattgccaacaacggtatcgcggccgtcaagtgtatgcgatcc
atcaggagatgggcctacgaaatgttcaagaacgagcgggccataaggttcgtggtgatg
gtcactccggaggatctaaaggcgaatgccgaatacatcaagatggcggatcactatgtg
cccgtgcccggcggatccaacaacaacaactacgccaatgttgaactaatcgtggacatt
gctcttcgtacccaagtgcaggccgtgtgggctggttggggtcatgcctccgagaacccg
aagctgccggagctcctccacaaagagggtctggtgttccttggtcctccggaacgtgcc
atgtgggcacttggtgacaaggtggcctcctcgattgtggcccaaacagccgaaattccc
accttgccgtggtccggttcggaactgaaggcccagtacagtggcaagaagatcaagatt
tccagtgaactcttcgcccgcggttgtgtgaccaatgtggaacagggtctggccgcagtt
aacaagattggcttccccgtaatgatcaaggcctcagaaggaggtggtggcaagggcatt
cgccgtgtggacaccgctgaggagttccccggcctgttccgccaggttcaagctgaggtg
cctgggtcaccgattttcgtgatgaagctggctcgcggagctcgccacttggaggtgcaa
ctgttggcggatcagtacggcaatgccattagcttgtttggtcgtgactgctccatccag
cgtcgtcatcaaaaaattattgaggaagcccctgccatcgtggcccagccagaagtgttc
gaggacatggagaaggccgcagtgcggctggccaagatggtgggttacgtcagcgcggga
accgtggagtatctttatgatccggagggtcgctacttcttcctggagctgaacccccgt
ctgcaggtggagcatccgtgtacggagatggtggccgatgtgaatcttcccgctgctcag
ctgcagattggaatgggaattcccctttaccggctcaaggacatccgtctgctgtatgga
gagtctccgtggggctcctctgtcattgacttcgaaaatccaccgaacaaaccgcgtccc
tccggacatgttatcgccgcccgtatcacctcagagaatcccgacgagggctttaagccc
agctcaggaaccgttcaggagcttaacttccggtcgagcaaaaatgtgtggggctacttc
agtgtggctgccagtggaggactgcacgagttcgcggactcacagtttgggcattgtttc
tcctggggcgagaaccgtcagcaggctcgagagaacctggtgattgccctaaaagagctg
tctattcggggtgatttccgaaccacagtggagtacctgatcactctgttggagacgaat
cgattcctggacaacagcatcgacaccgcttggttagatgccttgatcgcagaacgtgtg
caatccgagaaaccggatatattgttgggcgtaatgtgcggatcgttgcacatcgccgat
cgtgaaatcactgaaagcttctccagctttcagacctctctggaaaaagggcagatccaa
gcagctaacacgctgacaaacgtggtggatgttgagctaatcaacgatggcatccgttac
aaagtgcaggccgccaagagcggagccaactcgtacttcctgctgatgaacaactcgttt
aaggagatcgaggtgcatcgcctttccgacggaggcttgctcatctctttggagggtgcc
tcctacaccacgtacatgaaggaggaggtggatcgctaccgcattgtgattggcaaccag
acatgtgtcttcgaaaaggagaacgatccttcgctgctgcgcagtccctctgcgggaaag
ctcatcaacatgattgtagaagatggcgcacatgtaagcaagggacaggcctatgctgag
attgaggtgatgaagatggtgatgactctaacatctcaggaggcaggcacagtgacgttt
gtgcgtcgcccaggagctgttctggatgcaggatcccttttgggccatctagagctggat
gatccatcgctggtgacgaaagcgcaaccgttcaagggtcagttcctgcagccagagaat
gcaccggtgcccgaaaaacttaatagggtgcacaatacctacaagagcatccttgaaaac
actctagctggctactgcctgccagaaccattcaatgcgcagcgactgagagacattatc
gaaaaattcatgcaaagtttgcgagatccctcgttaccgctgctggaactgcaagaagtt
atcgcctccatctcaggtcgcatacccatctccgtggagaagaagatccgaaaactgatg
acgctgtacgagcgtaacataactagtgtcctggctcaattcccatcgcagcagatcgcc
agtgttattgacagccatgcggccacactgcagaagcgcgctgacagagatgtcttcttc
ctgaccacccagagcattgtgcagttggtgcagcgctataggaatggaatccgcggcaga
atgaaggccgccgttcatgagctgctgcgtcagtactacgacgtagagtcgcagttccaa
catgggcactacgacaaatgcgtgggactggtgcgagagcacaacaaggacgacatgcag
acggtggtcaacaccatcttctcgcactctcaggtggccaagaagaatctgctggttact
ctgcttatcgatcacctgtgggcgaacgaacctggtctaaccgacgaattggccaacaca
ctgagtgaattgacatctttaaatcgagctgagcactctagagtggctctgcggtcccgt
caagttctgatcgcagcccaccagccggcctatgaactgcgccacaatcaaatggagtct
atcttcctctccgccgttgacatgtacggtcatgacttccaccccgagaacctgcagcgc
ctgattctgtcggagacctcaatcttcgacatcctacacgacttcttttaccactctaac
cgggcagtgtgcaatgctgctctggaagtctatgtgaggagagcctacacatcctacgag
ttgacatgcttgcagcatttggaactctccggtggcctgtcgctggtgcacttccagttc
ctcctacccacagctcacccgaacaggctgttctcgcgcatgtcctcccccgatggattg
gatcaggcagcggcagagtccctgggaagctcattcgtgcgcaccggagcgatagcagcc
tttgactcttttgaacactttgaaatgtactcggacgagattttggatctgctcgaagac
tttgtctcgccggccatggttaatgccaaggtactggaggccgtggaggcggcagattcc
atttcggacagtcgacacagcacctcgatcaatgtgtcgttgtcggatcccgtaactcgg
gcgaatgctgcagaagaggcaaagtccacggaaccgattcacattgttagtgtggctgtg
agagaaacgggcgagttggatgacctgcaaatggcacagatctttggaaactattgccaa
gaacataacgaggagctcttccagcgacgcattcgtagaattacttttgctgctctgaaa
aagcggcaatttcccaagtttttcaccttcagagccagagataagttcgcagaggatcgg
atttaccggcatctggagccagcatctgctttccatctagagctgaatcgcatgaagaca
tacgatcttgaggctttgcccactgctaaccaaaagatgcacctgtaccttggcaaggcc
aaggtgtctaaaggtcaagaggtcacggactaccgctttttcattcgctcgattatccgt
cattcggatctaattaccaaggaagcctctttcgagtatctccaaaacgaaggagagcgc
gtgcttctcgaggccatggatgagctggaggtggcattctcgcatcctcatgccaaacgc
accgactgcaaccacatcttcctgaactttgtgcccactgtcatcatggatccggctaag
atcgaggagtctgtgacaaagatgattatgcgatatggtccgcgactgtggaagctgcgt
gtactacaggctgagcttaagatggtcatccgtcagtcaccacagtcacccactcaggca
gtgcgtctgtgcattgcaaatgactccggctacttcctggatatttcgatgtacacggag
caaacggaaccagagacaggaatcattaaatttaaggcctacggtgaaaagcagggatct
ctgcacggccatcccatttccacgccctacatgaccaaagacttcctgcagcagaaacga
ttccaggcgcagtccaacggtaccacctatgtctatgatgtgcccgacatgttccgccag
atgaccgagcgtcactggagagaattctccaaggcgcgtcccaccgtcgatattcgcact
cctgacaagattttaatcgaatgcaaggagcttgtcctcgagggcgacaaccttgtagag
atgcagcgtctgcctggcgaaaacaattgcggcatggtggcttggcgcattgtcttggct
actcccgaatatccgaatggtcgtgagattattgttatagccaacgacctcacctacttg
attggttcctttggaattaaggaggacgttctatttgccaaggcttcccaattagctcgt
caactcaaagtaccaaggatatacatctccgttaacagcggtgcacgcatcggactggct
gaggaggttaaagctatgtttaagattgcatgggaggatccagaggagccagataagggt
tttaagtacctctacttgagcaccgaggactacgcacaggtggccaacctgaattcggtg
agggctatcctgattgaggacgagggcgagcagcgctacaagattaccgacattatcggc
aaggacgacggtctgggcgtggagaacctacggtacgccggcttaattgccggtgaaacg
tcgcaggcctacgaggagatagttaccatcgccatggttacctgccgtactattggcatt
ggatcctatgtggtgcgccttggccagcgggttatccagatcgataattcacacattata
ctcacaggctatgctgccctcaacaagctgcttggacgcaaggtgtatgcctccaataat
cagttgggtggcacgcagattatgtttaacaacggagttacccacaaaaccgaggccatc
gacttggacggtgtctacaccatcctcgactggctctcgtacattcccgcgtacatcggt
tgtgacctgcccattattctgcccagcgatcgtatcgatcgccccgtggacttcatgccc
accaagtcgccgtacgatccgcgctggatgctaggcggccgtgtgaatcccgtaaacgcg
aatgactgggagaacggtttctttgaccgggactcctggagcgaaatcatggcctcgtgg
gccaagacggtagtcactggtcgcgcccgtctaggtggtgttcccgtgggagtaatagcc
gttgagacccgcaccgtagaagtggagatgcccgcagatcccgccaatctcgattcggaa
gccaagaccctgcagcaagcagggcaggtgtggtaccctgattcctcgtacaaaactgct
caagcaatcaaagattttggacgagaggagttgccgctgattgttttcgctaattggcga
ggcttctccggtggcatgaaggacatgtacgagcaaatcgtcaagttcggagcatacatt
gtcgacggtctgcgggagtacaagaagccggtgctcatctacctgccgcccaatgccgag
ctgagaggtggggcctgggccgtgctggattccctcattaacccgcgctacatggaaacg
tatgccgatccggaagccaggggtggagttctcgagccagagggcattgtggaaataaag
tacaaagagaaggatttggtgaagacgattcatcgattggatccgaccaccattgcgctg
aaaaaggagttcgatgaggcaaacgcgtctggtgacaaggtcagggctactcaggtggac
gaaaagattaaggcccgcatcgctgtgcttatacatgtctaccacacggtagcagttcac
tttgccgacctgcacgacacgccggagcgaatgctagaaaaggagtgtatcagtgagatt
gtgccttggcgcgactcccgccgttggctgtactggcgtctgcgacgtctgctgttggag
gacgcatatattaagaagatcctgcgtgctcaggataacctctccgtgggtcaggccaag
cagatgctgcgccgctggctggtagaggagaagggtgccacagaggcttatctgtgggac
aaaaacgaggaaatggtgtcttggtatgaggaacagagcaatgccgaatctatcgtttcg
cgcaacgtgaactccgtaagacgggatgccattatttctactatttcgaaaatgctcgag
gactgtcccgacgtagcgctggacgctgtagttggtctttgccaaggtctgacgcccgta
aatcgtggcgtggtcgtacgcacattagcccagatgcaactaaatgaggagacctctaac
agcaaccagggatga

DBGET integrated database retrieval system