KEGG   Drosophila yakuba: Dyak_GE23939Help
Entry
Dyak_GE23939      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dya  Drosophila yakuba
Pathway
dya00260  Glycine, serine and threonine metabolism
dya01100  Metabolic pathways
dya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dyak_GE23939
Enzymes [BR:dya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Dyak_GE23939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 VHS
Motif
Other DBs
NCBI-GeneID: 6537907
NCBI-ProteinID: XP_002098447
FlyBase: FBpp0268949 FBgn0241082
UniProt: B4PNU9
Position
3R
AA seq 384 aa AA seqDB search
MTSIHSVVDLRSDTVSQPTDKMRARMAAAVVGDDVYGEDPTVNELEARTAAIFGKEAGLF
VPSGTMGNLLAIMVHCHRRGTEALVGDLSHIFLYEQGGASHLAGVQLATLKNEQDGTFSL
QELRRRIRHNDCHEPITSLVVVEQTHNICGGKVVPLAFLDELAAVIRQPGVGTGNARIAL
HMDGARVFNAATALGVGVERICRDFDSVSICLSKGLSAPVGSVLVGTKAFISEAHRLRKA
LGGGMRQVGVLAAAGLVALDEVVPLLAKDHERTKKIANAIYELKSPNITVDLETVQSNIL
LVEITQPKLTASDFSTRLSIVDAGEVEAGVTDKKGAGIVVKASARDWAFARVVLYHQVDD
EQVELAIRKLKYVIGQYDKQWPRS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacctccatccactccgttgttgacctgcgctcggacaccgtcagccagcccacggac
aagatgcgggcccggatggccgccgccgtggtcggggatgatgtctacggcgaggatccc
accgtcaacgaactggaggcgcggacagcggccattttcggcaaggaggcgggcctcttt
gtgcccagcggcaccatgggaaatctactggcaattatggttcactgccatcgtcgtggc
acggaggccctggtcggcgatttatcgcacatctttctgtacgaacaaggtggcgcctcg
catttggccggagtccaattagccactctgaagaacgagcaggatggcaccttcagtcta
caggagctgcgccgcaggattcgccacaacgactgccacgagcccatcacctcgctggtg
gtggtggagcaaacccacaatatctgcggcggcaaagtggtgcccctggccttcctggac
gagctagctgctgtcatccgtcagccgggtgtgggcactggcaacgcccgcatcgccctc
cacatggatggtgcgagggtcttcaatgcggccaccgccttgggcgtgggagtggagcgc
atctgccgcgacttcgattcggtatccatctgcctcagcaagggcttatcggctcccgtg
ggatccgtgctagtcggcaccaaggccttcatttcggaagcacatcgattgcgcaaagct
ttgggaggcggcatgcggcaggtgggagtgctggcagcagctggactggtggccttggat
gaagtggttccacttctggccaaagatcacgagcggaccaagaaaattgccaacgccatt
tacgaactgaaaagtcccaacattaccgtggacctggagactgtgcagagcaacatcctt
ctggtggagataacccaacccaaactgactgccagtgacttctccacccggttgagcatc
gttgatgctggcgaggtggaggccggagtgacggacaagaagggagccggcatcgtggtg
aaggccagtgcccgggactgggcatttgcgagagtggtgctctaccatcaggtggacgat
gagcaagtggagctggccatcaggaagctgaagtacgtcatcgggcagtacgacaagcaa
tggcccaggagctag

DBGET integrated database retrieval system