KEGG   Drosophila yakuba: Dyak_GE24292Help
Entry
Dyak_GE24292      CDS       T01068                                 

Gene name
Dyak_Tm2
Definition
(RefSeq) Tm2, isoform B
  KO
K10374  tropomyosin 2
Organism
dya  Drosophila yakuba
Brite
Cytoskeleton proteins [BR:dya04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Dyak_GE24292 (Dyak_Tm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 DUF745 ERM MscS_porin ATG16 EzrA Laminin_II CLZ Cep57_CLD_2 BST2 Reo_sigmaC APG6 Spc7 TTKRSYEDQ BCL_N DUF1664 BicD Uds1 Alanine_zipper Fez1 WEMBL HOOK Golgin_A5 Polysacc_deac_2 DUF724 AAA_13 Laminin_I
Motif
Other DBs
NCBI-GeneID: 6537207
NCBI-ProteinID: XP_002097765
FlyBase: FBpp0355015 FBgn0068017
UniProt: B4PS57
Position
3R
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTA
KEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
HAEKQVKRLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataacgccatcgac
aaggccgacacctgcgagaaccaagccaaggatgccaactcccgcgccgacaaactgaac
gaggaggtgcgcgatctggagaagaagttcgtccaggtggagatcgatctggtcaccgcc
aaggagcagctggagaaggccaacaccgagctggaggagaaggagaagctcctgaccgcc
accgagtccgaggtggccacccagaaccgcaaggtgcaacagattgaggaggatctggag
aagtccgaggagcgctcgaccaccgcccaacagaagctgctggaggccacccagtcggcc
gatgagaacaaccgcatgtgcaaggtgctggagaaccgttcccagcaggatgaggagcgc
atggaccagctgaccaaccagctgaaggaagcccgcatgctggctgaggatgccgatacc
aagtccgacgaggtctcccgcaagctggccttcgttgaagacgagctggaggtggctgag
gatcgtgtccgctccggcgagtccaagatcatggagctggaggaggagctcaaggttgtc
ggtaactccctgaagtccctggaggtgtccgaggagaaggccaaccagcgcgtggaggag
ttcaagcgcgagatgaagaccctgtccatcaagttgaaggaggccgagcagcgcgccgag
cacgccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagaggacgagttg
ggcatcaacaaggacaggtacaagtccctggccgacgagatggactccacattcgccgag
ttggctggctactaa

DBGET integrated database retrieval system