KEGG   Drosophila yakuba: Dyak_GE24384
Entry
Dyak_GE24384      CDS       T01068                                 
Name
(GenBank) uncharacterized protein
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
dya  Drosophila yakuba
Pathway
dya04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dya00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dyak_GE24384
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dya01001]
    Dyak_GE24384
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dyak_GE24384
Protein kinases [BR:dya01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   Dyak_GE24384
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal YrbL-PhoP_reg Pox_A51
Other DBs
NCBI-ProteinID: EDW97339
FlyBase: FBgn0241504
UniProt: B4PR17
Position
3R
AA seq 537 aa
MQRRERQASGGGPQSTTAGPSAGNVANATTALAGGKSSSNNMYSTRQSVSTTTGVLMVGP
NFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAP
DGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHS
RHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARY
MSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEV
LCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPV
GSLQTGHEVIISPNKDRHNVTAKTNAKGGVAAWPDVPKPGATLGNLTPADRHGSVQVVSS
TNGELNPDDPTAGHSNTPITQQPEVEVVDETKCCCFFKRKKKKSTRQKXLDGVQCSPERE
AVTLLRATSHSNSRDSVLNNPSQDYIQQATSQHTLRYPPSASMLTPTPTTNTPTLPL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcagcgacgagaacggcaagcaagtggcggtggcccacaatcgacaactgccggtcca
tccgctggtaatgtggcaaatgccaccacagccctagccggtggtaagagctcaagcaat
aacatgtattccacccgccaatctgtaagcaccacaaccggtgtacttatggtcggacca
aattttcgtgtcggtaaaaaaattggctgtggtaattttggcgaattgcgtttaggcaaa
aatctttacaacaatgaacatgtagcaataaaaatggagcctatgaagtcaaaggctccg
caactacacttagagtataggttttataaactattaggatcacatgccgataacgcccca
gatggcataccacgcatttatcacttgggcacttgcggtggccgttacaatgccatggtt
ttagagttattgggattatcattagaagatctcttcaatatttgcgcccgtaaattttca
cttaagactgtattgatgatagcgaaacaacttctccaccggatcgaatatgttcatagt
cggcacttaatatatagggatgtgaaacctgagaactttctcattggcagaacgtcaaca
aaacgtgaaaaaattatacatataattgatttcggtttggccaaagaatacattgattta
gatacaaataggcatataccatatcgggagcataagtccctaactggaacggcacgttat
atgtcaatcaacacgcacatggggcgtgagcagtcgcgacgcgatgatctggaggcattg
ggacatatgtttatgtatttcttaaggggttcactgccgtggcaaggcctaaaggctgat
acactcaaggagagatatcaaaaaatcggtgatacgaaacgagcaacgcccatcgaggtg
ctttgtgatggacatccggaagagtttgcgacatatttgcgttatgtacggcggctagat
tttttcgaaactcccgactatgattttctgcgaagactgtttcaagacttattcgatcgt
aagggatacaccgacgagggcgagttcgactggacagggaagacaatgtcaacgcccgtc
ggatctctgcaaactggccatgaagtcatcatttcaccaaataaagatcgtcataatgtt
acggctaagacaaatgccaaaggaggtgttgctgcgtggcctgatgtgccaaagccgggg
gcaacactgggcaatctaacgccggccgatcggcatggttcagtacaggttgtgagttcg
acgaatggcgaactaaatccggacgatcccacggccggacactcaaacacacccatcaca
cagcagccggaagtcgaagtggtcgatgaaacaaaatgttgttgtttctttaaacgaaag
aagaagaaatcgacgcgccaaaaatgactagacggtgtacaatgtagtccagaacgcgag
gcagtcaccctgctgcgtgccacttcacattcaaactcacgggatagcgtattgaataat
ccgagtcaggattatatccaacaggcaacgtcgcagcatacgttgcgttatcctccatcc
gcgtcgatgttgacgccaacaccaactacaaacacaccgacacttccgttgtaa

DBGET integrated database retrieval system