KEGG   Drosophila yakuba: Dyak_GE24402Help
Entry
Dyak_GE24402      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dya  Drosophila yakuba
Pathway
dya00230  Purine metabolism
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dyak_GE24402
Enzymes [BR:dya01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     Dyak_GE24402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc
Motif
Other DBs
NCBI-GeneID: 6537030
NCBI-ProteinID: XP_002097597
FlyBase: FBpp0269412 FBgn0241521
UniProt: B4PQL3
Position
3R
AA seq 669 aa AA seqDB search
MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE
SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ
LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK
LTDGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK
ITLAGEKIVETWILHNPGVNPKTFIGSHILDRFKCRRPKDTQIQWQTILQMRTVLFEFEL
IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAGAGSSKDEI
DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL
SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR
KSEEHVCQSFEEVSVIFIEVLNVYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKV
ETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVAIRVGINSGPVVAGVVG
MKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVRKVGYKVEARGFVKVKGKGEME
TYWLLEGPE
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaatgctgtacgagagcgtgcagcactacatccagcaggagtacggcatggag
acctggcggaaggtctgccagatagtcgactgcaagcaccagagcttcaagacgcaccag
atctatccggacaagctgatgccggactttgcggctgccctgtccgccagcacgggcgag
tccttcgacttctgcatgaacttctttgggcgctgttttgtgcggttcttcagcaacttc
ggctatgacaagatgatccgctccacagggcgatacttctgcgacttcctgcagtccatc
gacaacatccacgtgcagatgcgcttcacgtatcccaagatgaagtcgcccagcatgcag
ttgaccaacatggatgatgatggggctgtgatcctgtatcggagcggccgaactggcatg
tccaagtacctgattggccagatgacagaggtggcaaaggagttctacggcctggacatg
actgcgtacgtcctggagagccaaaatgacatctgcggcggcacagctggtcccatcaag
cttacggacggtcctttgaccgtgattgtcaagtatcggctggacttcgataatcgcgat
tatatggccaagcgggtcaatgtcatcgcgcatccttcccagctcaagatgccgtcggtg
gatctgaacgtgttcctcgagctgtttcccttcaccattgtgctggatcacgacatgaaa
atcacacttgcgggcgagaagattgtcgagacgtggattctgcacaatcctggggtgaac
ccaaagacctttattggcagccacatattggatcggttcaagtgccgccgtcccaaggac
actcaaatccaatggcagaccattctgcagatgcgaaccgtcctctttgagttcgagctc
attcgcacgggtcacaaccgtgccgcttatgatgcggccttgaactttgacttcgaaaac
tttgatgaagccagcagcttgaacgaggcgcaggccatggccttggccagtgccaaggag
ttcagtgcggagaacgccaaggaagaggcagctggcgcaggcagctccaaggacgaaata
gatcccgcaacgggacagagacgccattcggtgggactccgatccatcctgctgaagggt
cagatgttctacatcaaagatgtggactcgctgatcttcctgtgcagtcctctaatcgaa
aatctggatgagctgcacggaattggtctctatctgaacgatctcaatccgcatggactg
agtagagagctagtaatggcgggatggcagcactgctccaagctggagatcatgttcgag
aaggaggagcagcgatcggatgagctggaaaagtcgctggaactggcagattcgtggaaa
cggcagggcgatgagctcctgtactccatgattcctcggcccattgccgagcgaatgcgg
aagagcgaggagcacgtgtgtcagagtttcgaagaggtgtccgtcattttcatcgaggtg
ctcaatgtctatgacagtggatccaacaacatccaggatgccatgcaggcggtgaccacc
ttgaataaagtgttttcggcattggatgaggagatcatttccccatttgtgtacaaagtg
gagaccgtgggcatggtatacatggctgtttcgggtgctccagatgtgaatcccttgcac
gccgagcacgcctgcgacttggccttgagggtgatgaagaaggtcaaggcccatgccctt
cccggagtggccatacgggtgggcatcaactccggacccgtggttgcaggagtggttgga
atgaaggttcctcgatactgcctctttggagacaccgtaaacaccgcctcgcgaatggaa
agcagcagtgatccttggatgatccagctatccaattacactgcgctgaaggtgaggaag
gtgggctacaaggtggaagcgcggggctttgtcaaggtcaagggcaagggcgagatggag
acctactggctgctggagggaccagagtag

DBGET integrated database retrieval system