KEGG   Drosophila yakuba: Dyak_GE24730Help
Entry
Dyak_GE24730      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
dya  Drosophila yakuba
Pathway
dya00740  Riboflavin metabolism
dya00860  Porphyrin and chlorophyll metabolism
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dyak_GE24730
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE24730
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     Dyak_GE24730
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     Dyak_GE24730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD GDP_Man_Dehyd adh_short NAD_binding_2 UPF0193 KR
Motif
Other DBs
NCBI-GeneID: 6536431
NCBI-ProteinID: XP_002097013
FlyBase: FBpp0269740 FBgn0068193
UniProt: B4PVF2
Position
3R
AA seq 204 aa AA seqDB search
MQRIAIIGGTGMTGECAVDHALLKGLSVKLLYRSEKTVPERFKSKVELVKGDVTNYEDVQ
RVIEGVEAVAVILGTRNKLEATTELSRGTENLIKAMKEAKLTKFSIVMSSFLLRPLNEVP
AVFHRLNEEHKRMLDLTKASDLDWIAILPPHIADEPATAYTVLHDDAPGRLVSKYDLGKF
IIDSLEQPEHYRKVCGIGKSPKSA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcattgctattattggaggaaccggcatgaccggcgagtgtgccgtcgatcac
gccctgctgaagggtctgtcggtaaaactgctatatcgcagcgaaaagacagttccagaa
cgattcaagtcgaaagttgaactggttaagggagatgtgaccaactacgaggatgtgcag
cgcgtcatcgagggcgttgaggcggtggccgtgattctgggcacccgcaacaagctggag
gccaccacggagctatcccgcggtactgagaacctcatcaaggccatgaaagaggccaag
ctgactaaattctccattgtcatgtcctcgtttctgctgcgtccgctcaacgaggtaccc
gctgtgttccatcgcctgaacgaggagcacaaacgcatgctggacctgaccaaggccagc
gacctggactggattgccattctgccgccgcacatcgccgatgagccggcgaccgcctat
accgtcctgcacgacgatgcccccggacgtctggtttccaaatacgacctgggaaagttt
attattgacagcctggagcagccggagcactaccgcaaggtttgcggcattggcaaaagc
cccaaaagtgcctag

DBGET integrated database retrieval system