KEGG   Drosophila yakuba: Dyak_GE25125Help
Entry
Dyak_GE25125      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dya  Drosophila yakuba
Pathway
dya00020  Citrate cycle (TCA cycle)
dya00640  Propanoate metabolism
dya01100  Metabolic pathways
dya01200  Carbon metabolism
Module
dya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dyak_GE25125
   00640 Propanoate metabolism
    Dyak_GE25125
Enzymes [BR:dya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Dyak_GE25125
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dyak_GE25125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA CoA_binding_2 Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 6535694
NCBI-ProteinID: XP_002096322
FlyBase: FBpp0270135 FBgn0242211
UniProt: B4PNH1
Position
3R
AA seq 342 aa AA seqDB search
MSLNRGSKVLLRAIAPQVLRRGKADYSKTICNLKINKQTKVLVQGFTGKQATFHSEESIK
YGTNIVGGVNPKKGGTEHLGKPVFKSVAEAAEKVKPDATVIFIPPPSAAEGICSAIESEI
GLIVAITEGIPQADMVRISQMLNCQEKSRLLGPNCPGIISPEQCKIGIMPGHIHKRGMVG
IVSRSGTLTYESVHQTTNVGLGQALCIGLGGDPFNGTSFVDALKVFLSDKEIKGIVMIGE
IGGSAEEEAADFLKEKNTGCEAKPVVGFIAGQTAPPGRRMGHAGAIISGGKGAAKDKVAA
LEKAGVRMTVNPCHLGSSLLEEMIRLKLVPKPSEKKAQAGKK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaaatcgaggaagcaaggtgctcctgcgggcgattgcgccccaagttttgagg
cgaggcaaagcggactatagcaaaacgatttgtaacctgaagatcaacaagcaaacaaag
gttctggtgcaaggattcaccggcaagcaggccactttccactcggaggagtccataaag
tacgggaccaatatagttggcggtgtgaatcccaaaaagggcggaacggagcatctgggt
aagccggttttcaaatcggtggcagaagctgcggagaaggtgaagccggatgccacggtg
atctttataccacctccatcggccgccgagggaatttgctcggccatcgagagcgaaata
ggcctgattgtggccatcaccgagggaattccccaggcggatatggtgaggatatcgcag
atgcttaattgccaggaaaaatcccgcctgctgggacccaactgcccgggaatcatctcc
ccggagcagtgcaaaatcggaataatgccggggcatattcacaagcgaggaatggtgggc
atagtctcgcgttcaggaactttgacctacgagtccgtccaccagaccaccaacgtggga
ttgggtcaggcactttgtattggcctcggcggagatcccttcaacggaaccagcttcgta
gacgccctcaaagtatttctgtccgacaaggagatcaagggcattgtcatgattggagag
attggtggatccgccgaggaagaagccgccgatttcctcaaggagaagaacacaggctgc
gaggccaagccagtggttggcttcatcgccggacagactgctcccccaggtcgccgaatg
ggtcacgccggtgccatcatttcaggtggtaagggagcggccaaggacaaggtggccgcc
ttggagaaggcgggagttcgcatgaccgtcaatccctgccacctgggctcctcgcttctc
gaggaaatgatccgtctgaaactggtgcccaagccgagcgaaaaaaaggcccaagctggc
aagaagtag

DBGET integrated database retrieval system