KEGG   Drosophila yakuba: Dyak_GE26043
Entry
Dyak_GE26043      CDS       T01068                                 
Name
(GenBank) uncharacterized protein, isoform A
  KO
K00288  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase / formyltetrahydrofolate synthetase [EC:1.5.1.5 3.5.4.9 6.3.4.3]
Organism
dya  Drosophila yakuba
Pathway
dya00670  One carbon pool by folate
dya01100  Metabolic pathways
dya01240  Biosynthesis of cofactors
Module
dya_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dyak_GE26043
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dya04147]
    Dyak_GE26043
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Dyak_GE26043
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Dyak_GE26043
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Dyak_GE26043
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE26043
SSDB
Motif
Pfam: FTHFS THF_DHG_CYH_C THF_DHG_CYH AcetDehyd-dimer Peptidase_C39
Other DBs
NCBI-ProteinID: EDW96821
FlyBase: FBgn0068419
UniProt: B4PKR2
Position
3R
AA seq 968 aa
MSAQYQRFLKVLEKWPAEKSKVGSGEWTAEPAIKMSGAKIISGTAVAKSIREELRNEVTA
MGKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGIDAVHVQLPRSITEVELLDKIN
DLNEDPRVHGIIVQMPLDCDTTIDSHRITDAVSPEKDVDGLHTVNEGRLAIGDLGGFLPC
TPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELLKWANATVTVCHSKTRNLEEITR
SADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDATKASGSKLVGDVDYAEALQVAGH
LTPVPGGVGPMTVAMLMKNTVRSAARFLERLATNQWALQTLPLKPLRPVPSDIVIARAQK
PKDIAVLAKEIGLEAREVSLYGNKKAKISLSVLERLKDKEAGHYVVVAGMTPTPLGEGKT
TTLMGLVQALGAHKLRNTMAALRQPSQGPTFGIKGGAAGGGYAQVIPMEEFNLHLTGDIH
AVSAANNLLAAQLDTRIFHENTQKDKALYDRLVPAIKGLRKFSPIQLRRLQKLGITKTDP
NTLTEEEYGPFARLDIDPETIMWERVVDINDRYLRTITVGQSPTEKGITRETRFSISVAS
EIMAVLALSRSLEDMKQRLADMVVAFDKRGKPVTADDLGVTGALAVLLKDALEPNLMQSL
EGTPVLVHAGPFANIAHGCNSIIADEVGLKLVGKDGFVCTEAGFGSDIGMEKFCNIKCRT
SGRKPNAMVLVATVRAIKMHGGGAPVTPGAPLNKQYTEENLELVQKGLPNLLQHIENGKA
FGMPVVVSLNAHSADTPAEHELVKKAALEAGAFAAVVSTHWADGGAGAVELADAVIRACE
QGNQFRLLYDLELPLVDKMNKIATTMYGAGKVVLSPAAEEKIKRLTDAGFGNLPICMSKV
SGSFTGDAKIKGAPKGFTLDVEDVYVSAGAGFVVAMCGEVTKMPGLPTRPAIYDIDLNTE
TGQIEGLF
NT seq 2907 nt   +upstreamnt  +downstreamnt
atgtcggcgcagtaccaaagattcctaaaagtactcgaaaagtggccagcggagaaatcg
aaagtcggcagcggagagtggacagcagagccggcgatcaagatgagtggggccaagatc
atatcgggcacggcggtggccaaatccattcgcgaggagctgcgtaacgaggtgacggct
atgggcaaacagttggcggactttgtgcccggcctgaggatcgtccaggtgggtggacgc
gaggactccaacgtttacatccgcatgaagatcaaggcggctacggagatcggcatcgat
gccgtccacgtccagttgccccgatccatcaccgaggtggaactgctcgataagatcaac
gacctcaacgaggatccacgggtgcacggcatcatagtgcaaatgcccctggattgtgac
accaccatcgattcgcatcgaattacggacgccgtttccccggaaaaggatgtggacggc
ttgcacacggtcaacgaaggtcggctggccatcggcgaccttggtggattcctgccctgc
acaccttggggttgcctggagctgatccgccgttctggcgtagagatcgccggagccagg
gctgtggttctgggacgcagcaagatcgtgggcactcccgccgctgagctgctcaagtgg
gccaatgccacggtcaccgtgtgccactcaaagacgcgcaacctggaggagattacccga
agtgcagacattctggtggtcggcatcggagtagccgagatggtcaagggatcgtggata
aaacccggtgctgtggtcattgattgcggcatcaatgtaaagccagacgccaccaaggcc
agtggcagcaagctggtcggggacgtggactacgcggaagctctccaggtggcaggacat
ttgacgcccgtgcccggcggcgtgggacccatgacggtggccatgctgatgaagaacacc
gtgcgctctgcggcccgattcttggagcgtctggctacgaaccagtgggccctacaaacg
ctgcccctcaagcccctgcgtcccgtgcccagcgacattgtgattgcccgtgcccaaaaa
ccgaaggacattgccgtgttagccaaggagatcggtctggaagctcgggaggtttcgctg
tacggcaataagaaggccaagatttccctgtcagtgctggagcgtctgaaggacaaggag
gcgggtcactatgtggttgtagccggcatgacacccacgcctttgggcgagggtaagacc
accacactgatgggcttggtccaggctctgggcgcgcacaagctgagaaacaccatggct
gctctgcgacagccatcccaaggcccaacctttggcatcaaaggtggagctgctggcggg
ggctacgcgcaggtgatccccatggaggagttcaatctccatctgacaggagacatccat
gcggtgtctgcagccaataacctgctggccgcccagttggacacccgcatcttccacgag
aatacccaaaaggacaaggccttgtatgacagattggtgccagcgatcaagggtctgcgg
aagttcagccccattcagctacgccggctccagaaattgggcatcaccaaaaccgatccc
aatacccttaccgaagaggagtacggtcccttcgcccggctggacatcgatccggagacg
attatgtgggagcgggtggtggacatcaacgatcgctacctacgcaccattaccgttggg
caatcgcccaccgagaaggggattacgagggagaccaggttctccatctcggtggccagc
gagatcatggctgtgctggcgctatcccgaagtctggaggacatgaagcagcggctggct
gacatggtggtggccttcgacaaacggggcaagcccgtgaccgctgacgatttgggtgtc
accggtgccctagcagttcttctgaaggacgcactcgagcccaacctgatgcagtccctc
gagggaactccagtgctggtgcacgccggtccctttgccaacatcgcccacggctgcaac
tcgatcatcgctgatgaagtcggcctaaagctggttggtaaggatggatttgtctgcacg
gaggcaggattcggatcagacattggcatggagaagttctgcaacattaagtgccggaca
tccggccgcaagccgaacgccatggtgctggtggccactgtgagggccatcaagatgcac
ggtggcggagctcccgtcacccccggcgcccccttgaacaagcaatacacggaggagaac
ttggagcttgtccagaagggtctgcccaatctgctgcagcacatcgagaacggcaaggcc
tttggcatgccagtggtggtgagcctgaatgcccattcagccgacactccggcggagcat
gagttggtcaagaaggctgctctggaggcaggtgccttcgccgccgtagtgtccactcac
tgggcggacggaggagccggtgccgttgagctggccgatgcggtgatcagagcctgcgag
cagggcaaccagttccgattgctctacgatctggagctgccgctggtggataagatgaac
aagatcgccacgacgatgtacggtgctggaaaggtggtgctctcgccggcggctgaggag
aagatcaagcgcctgacggatgcgggctttggcaatcttcccatctgcatgtccaaggtc
tccggctccttcactggcgacgcgaagatcaaaggcgcccccaagggcttcaccctggac
gttgaggacgtatatgtttccgccggagccggcttcgtggtggccatgtgcggtgaggtc
accaaaatgccgggtcttcccacccgcccggctatctacgatatcgatctgaatacggaa
accggacagattgagggcctgttttag

DBGET integrated database retrieval system