KEGG   Drosophila yakuba: Dyak_GE26197Help
Entry
Dyak_GE26197      CDS       T01068                                 

Gene name
Dyak_Desat2
Definition
(RefSeq) desaturase 2
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dya  Drosophila yakuba
Pathway
dya01040  Biosynthesis of unsaturated fatty acids
dya01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dyak_GE26197 (Dyak_Desat2)
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dyak_GE26197 (Dyak_Desat2)
Lipid biosynthesis proteins [BR:dya01004]
 Desaturase
  First
   Dyak_GE26197 (Dyak_Desat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase DUF1129
Motif
Other DBs
NCBI-GeneID: 6536826
NCBI-ProteinID: XP_002097396
FlyBase: FBpp0271207 FBgn0243231
UniProt: B4PPA2
Position
3R
AA seq 358 aa AA seqDB search
MAPYEPSSNSSKQTGVLFEGDAETADGDLTSDRFQLKRAENRRLDLVWRNIILFALVHLS
ALYGLYSIFTKAKLATTLFAAGLYIIGMLGVTAGAHRLWAHRTYKAKWPLRLILVIFNTV
AFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPDIKEKGKGLDLSD
LRADPILMFQRKHYYILMPLACFVLPTVIPMVYWNETLASSWFVASMFRWCFQLNMTWLV
NSAAHQFGNRPYDKTMNPTQNAYVSAFTFGEGWHNYHHSFPWDYKTAEWGRYSLNITTAF
IDMFAKIGWAYDLKTVAPDMIQRRVLRTGDGSHELWGWGDKDLTPEDARNVLFVDKRS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctccctatgagccctcttctaattcttccaaacaaacgggtgtcctattcgaaggc
gatgcggaaacagccgacggagacctcactagcgatagattccagttgaaacgagcagaa
aaccgtcggcttgatctggtctggcggaatataatcctgttcgctttggtgcacctgtct
gcactatatggcctctactccatattcacaaaggcgaaactcgccaccacactttttgct
gccggattgtatatcattggcatgctgggcgttacagccggtgcccatcgcctttgggcg
catcgcacctacaaggccaagtggcccctccgcctgatcctggtcatcttcaacacggtc
gcctttcaggatgccgcctaccactgggcccgtgaccatcgcgtccaccacaaatactcg
gagactgatgccgatccgcacaacgccacccgtgggttcttcttctcgcacgtcggctgg
cttctgtgcaagaaacatccggatatcaaggaaaagggaaagggactggacctttccgac
ctgcgcgccgatcccattttaatgttccagcgaaagcactactatatcctcatgcccctg
gcgtgctttgttctgcccactgtcattccaatggtttactggaatgagacactggcctcc
tcctggttcgtggccagcatgttcaggtggtgcttccagctgaacatgacctggttggtg
aacagtgcggcccaccaattcggaaatcgtccatacgacaagaccatgaatcccacccag
aatgcttatgtatcggcctttacgtttggcgagggatggcacaactaccatcattccttc
ccatgggactacaagacggccgaatggggtcgctactccctgaacataaccacggccttc
atcgacatgttcgccaagatcggctgggcctacgacctcaaaacggtggctcccgacatg
atccagcggcgggtactccgcactggcgacggttcccacgagctgtggggctggggcgat
aaggacctgacaccggaggatgccaggaacgtgctcttcgtcgataaaagatcataa

DBGET integrated database retrieval system