KEGG   Drosophila yakuba: Dyak_GE26447Help
Entry
Dyak_GE26447      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
dya  Drosophila yakuba
Pathway
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE26447
   04215 Apoptosis - multiple species
    Dyak_GE26447
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dya01002]
    Dyak_GE26447
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dya03110]
    Dyak_GE26447
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     Dyak_GE26447
Peptidases [BR:dya01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dyak_GE26447
Chaperones and folding catalysts [BR:dya03110]
 Other chaperones and cochaperones
  DegP / HtrA
   Dyak_GE26447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 Peptidase_S46 PDZ Tricorn_PDZ Hjc PDZ_1
Motif
Other DBs
NCBI-GeneID: 6537306
NCBI-ProteinID: XP_002097864
FlyBase: FBpp0271457 FBgn0243468
UniProt: B4PST0
Position
3R
AA seq 422 aa AA seqDB search
MALRGSHRLEVIFKRCIASPVFHSHAANRRSSQLAIKGTDPSSNGNSGQDQQNGEQKAKG
WRRLVRFFVPFSLGAAVSAAVIKREDFTPTIAASKMTGRRRDFNFIADVVAGCADSVVYI
EIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPAT
IEDVDQTSDLATLRIQVNNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQR
ASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKV
FLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSHLTHGVLVWKV
IVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKNLDIVILRGVKQMHVTITPE
DP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcgcggttcccaccgcttggaagtgatcttcaaacgctgcattgcatctccg
gtgttccacagccacgcagccaatcggcggagcagccaactagcgatcaaaggcaccgat
ccaagcagcaatggtaacagtgggcaagatcagcaaaatggtgaacaaaaagcaaaaggc
tggaggcgattggttcgtttctttgtgcccttctccctgggcgccgcggtcagtgcggcg
gtcattaagcgggaggactttactccaacgatcgccgcttcgaagatgacaggacgtcgg
cgggacttcaacttcatagccgatgtggtggcaggttgtgcggattcggtggtctacatt
gagatcaaggacacccgccactttgactacttcagtggccagccgatcaccgcatcgaat
ggctccggctttatcattgagcagaacggtctcatcctgaccaacgctcatgtggtgatc
aacaaaccccacacaatggtacaggtgaggctgtccgacggcaggacttttcccgccacc
atcgaggacgtggatcagacatccgatcttgcgactttgcgcatacaggtgaacaatctt
tcggtgatgcggttgggcaagagcagtaccctgcgatcgggcgaatgggttgtggccctg
ggcagtccgctggccctaagcaatacggtgaccgctggagtaatcagttccacgcagcgt
gcatcccaagaacttggccttcgaaacagggacatcaactacctgcaaacggatgctgcg
attacgtttggcaactccggcggacccttagtcaatctggatggcgaggccattggagtt
aactcgatgaaggtgacggctggcattagcttcgcaatacccattgactatgtaaaggtg
tttctggagcgggcggcggagaaacgaaagaagggctcggcctacaagaccggctatccg
gtcaagcggtacatgggcatcaccatgctgacgctcacaccggatatactgttcgagctc
aagtcacgaagtcaaaacatgcccagccacctaacgcacggcgtgctcgtgtggaaggtt
atcgttgggtcgccggcgcacagtggtggactacaacccggagacatagtgacccacata
aacaagaaagagatcaagaactcatcggatgtctacgacgccctggccgataatagtaaa
aaccttgatatagtgatcctgcgaggtgtgaagcagatgcacgtgaccattacgccagaa
gatccctag

DBGET integrated database retrieval system