KEGG   Drosophila yakuba: Dyak_GE28712Help
Entry
Dyak_GE28712      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
dya  Drosophila yakuba
Pathway
dya04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Dyak_GE28712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dya01001]
    Dyak_GE28712
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dya03036]
    Dyak_GE28712
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     Dyak_GE28712
Protein kinases [BR:dya01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   Dyak_GE28712
Chromosome and associated proteins [BR:dya03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dyak_GE28712
   Centrosome duplication proteins
    Regulators of centriole replication
     Dyak_GE28712
  Sister chromatid separation proteins
   Polo kinases
    Dyak_GE28712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plk4_PB1 Pkinase Pkinase_Tyr Plk4_PB2
Motif
Other DBs
NCBI-GeneID: 26535893
NCBI-ProteinID: XP_015044967
FlyBase: FBpp0364335 FBgn0276867
UniProt: A0A0R1E859
Position
3L
AA seq 342 aa AA seqDB search
GTPNYISPEVVSRSSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPA
HLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLKCSNGGHSTPGALNMFSQSMESADSG
IITFASSESRNSQQIRSVENSGPQQMLPQIHEEFKHHKLTYEQPGLFRQTSTGLAEPNWP
AAAKASAFRMEIGMVPTSKPAPVKEDRISVPPLNTKRLLSTRYKTKNAIMSILRNGEVVL
EFLKFRPTYNEDRIIDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYEN
LPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMT
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ggaacccccaactatatttcacctgaggtggtgtcacgctcgtctcacggactgcccgcg
gacgtctggagcgttggatgcatgctgtacaccctgctggtggggcgcccgcccttcgaa
actgatgcggtgcagtcaacccttaacaaagttgtaatgtccgagtatattatgccggct
cacttgtcttatgaggcgcaggacttgataaacaagttattaaaaaagctcccgcacgag
cggattaccttggaggcggttctctgccatccatttatgttaaaatgctcaaatggtgga
cactcgacgccgggagcgttgaatatgttcagccaaagtatggaaagcgccgacagtgga
atcataacatttgctagcagtgagtcccggaattcccagcaaattcgttctgtggaaaac
tcaggaccacaacaaatgcttccccaaatacacgaggaattcaagcatcataaattgact
tatgagcagccaggtttatttcggcaaacttcaactggcttggcagagccgaattggcca
gcagctgctaaggcttcagcgttccgcatggaaatcggcatggtacccacttctaaaccg
gcacctgttaaagaagatcgtatttcggtgccaccattgaacactaaaagactgctttcg
acgcgttataagacaaagaatgctataatgagtattttgcgtaatggggaggtagttctc
gagtttcttaagtttcggccaacgtataatgaagatcgcattattgacatttgtcgcata
tcggatgacggacagcgaatcataatttatcagccagatcctgggcgtggcttaccagta
agagagcagccaccagatctacaaataccaagtggagattgcgtatataattacgagaat
ttgcccagcaagcactggaaaaagtatatatacggcgctcgatttgtagggctggtaaaa
agcaaaacacctaaagtcacttacttcagtactctcgggaaatgccaattgatggagaca
atgaca

DBGET integrated database retrieval system