KEGG   Dyella sp. M7H15-1: EO087_01595Help
Entry
EO087_01595       CDS       T05846                                 

Gene name
metH
Definition
(GenBank) methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00270  Cysteine and methionine metabolism
dye00450  Selenocompound metabolism
dye00670  One carbon pool by folate
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EO087_01595 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EO087_01595 (metH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EO087_01595 (metH)
Enzymes [BR:dye01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     EO087_01595 (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Met_synt_B12 Pterin_bind B12-binding_2 B12-binding
Motif
Other DBs
NCBI-ProteinID: QAU22839
UniProt: A0A410UEX0
Position
complement(307522..310212)
Genome map
AA seq 896 aa AA seqDB search
MNTSRHTCLSGLEPLVITPDLLFVNVGERTNVTGSAQFKKLIKEERYEEAIDVARQQVAN
GAQIIDVNMDEGLIDSEAAMTRFLNLIAAEPDIARVPVMVDSSKWTVIEAGLRCLQGKGV
VNSISMKEGEDIFLEHARKVLEYGAAVVVMAFDEQGQADTCARKVEICSRAYQLLTEKLD
FPPEDIIFDPNIFAIATGIEEHNNYAVDFIEATRELKKRFPLSHISGGVSNVSFSFRGNN
TVREAIHSVFLYHAIKAGMDMGIVNAGALMIYDDVPAQLREHVEDVVLNRRSDATERLLD
IADQYKAKKGEVVVENLAWREKSVQNRLAHALVHGIDQFVDEDAEEARQQASRPLDVIEG
PLMDGMNIVGDLFGAGKMFLPQVVKSARVMKKAVAYLLPYIEEEKLRTGDAGKNNGTIVM
ATVKGDVHDIGKNIVGVVLRCNNFEVIDLGVMVPAQKILDTAREHNADIIGLSGLITPSL
EEMSQVAREMQRQDFKIPLLIGGATTSRAHTALKIEPHYKAPTVWVKDASRAVGVAQSLV
SQDLLDNFMTKIRAEYADIRERHKHRGTAKTLVPLEHARNQRFQGDWANYTPPQPNKPGL
TAFDHYDLAELREYIDWTPFFQTWELAGRYPAILGDAMVGTQAIELFADAQAMLDKIIAE
RWLTARAVIGFWPAHRVGDDIVLSSHDGKKTHDLHHLRQQAEKPVERPDFCLSDFIAPKE
ANKQDWLGGFAVTAGIGIEQHVARFEAAHDDYSAILLKALADRLAEAFAERMHERVRREF
WGYQPNETLDNEALIDEKYRGIRPAPGYPACPDHTEKATLFKLLNAPHNTGIELTDSFAM
YPTAAVSGWYFSHPDSQYFVVGRITREQVNDYAKRKGWTREETERWLAPNLDYDPE
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctcacgccacacctgcctctccggcctggaaccactggtcatcacccccgac
ctgctgtttgtcaacgtcggcgagcgcaccaacgtcaccggctcagcccaattcaagaag
ctgatcaaagaagagcgctacgaagaagcgatcgacgtcgcgcgccagcaggttgccaat
ggcgcccaaatcatcgacgtgaacatggacgaaggcctgatcgattccgaggcggcaatg
acgcgcttcctcaatctgatcgccgccgaacccgatatcgcacgcgtgccagtgatggtc
gactcgtccaaatggacggtgatcgaagcaggcctgcgctgcctgcaaggcaaaggcgtg
gtcaattcgatctcgatgaaggaaggcgaggacatcttcctggagcacgctcgcaaggtg
ctggaatacggcgccgccgtcgtcgtgatggcgttcgacgaacagggccaggccgatacc
tgcgcgcgcaaggtggagatctgttcccgcgcctaccaactgttgactgaaaagctcgat
ttcccaccggaagacattatcttcgaccccaacatcttcgccatcgccaccggcatcgag
gaacacaacaactacgctgtggatttcatcgaagctacccgcgagttgaagaaacgcttc
ccgcttagtcacatctccggcggtgtatccaacgtctcattctcgtttcgcggcaacaac
acggtgcgcgaggcgatccactccgtgttcctgtaccacgccatcaaggcgggcatggac
atgggcatcgtcaacgccggcgccttgatgatctacgacgacgtacccgcacaattgcgc
gaacacgtcgaagacgtggtgctcaatcgacgttccgatgctaccgaacgcttgctggac
attgccgatcagtacaaagccaagaaaggcgaagtcgttgtcgagaacctagcctggcgc
gaaaagtcggtacagaaccggcttgcgcatgcactcgtgcacggcatcgaccagttcgtc
gatgaagacgccgaagaagcacgccagcaggccagccgtccgctggatgtgatcgaaggc
ccactcatggacggcatgaacatcgtgggcgatctgtttggcgccggcaagatgttcctg
ccgcaggtggtgaaatccgcccgcgtgatgaaaaaggccgtggcctacctgctgccatat
atcgaagaggaaaaactgcgcaccggcgacgctggcaagaacaacggcaccatcgtgatg
gccaccgtgaagggcgatgtgcacgacatcggcaagaacattgtcggggtggtactccgc
tgcaacaacttcgaggtgatcgatcttggcgtgatggtaccagcgcaaaaaatcctggac
acagcgcgtgaacacaacgcagacatcatcggcttgtctggtctgatcacgccgtcgctg
gaagaaatgagccaggtcgcgcgcgagatgcagcgccaagacttcaagattcccttgttg
attggcggcgccaccacctcgcgcgcgcataccgcgctgaaaattgagccccactacaag
gcgcccacggtatgggtgaaggacgcatcacgcgccgtgggcgtggcgcaatcgctggtg
agccaggatctgctcgacaacttcatgacgaagatccgcgccgagtacgccgacattcgc
gaacgccacaagcatcgtggcacagccaagaccttggtgccgctggaacatgcgcgcaac
caacgcttccagggcgactgggccaactacacgccgccacagcccaacaagcccggcctg
accgctttcgaccactacgaccttgccgaactgcgcgaatacatcgactggacccccttc
ttccaaacgtgggaactggctggccgctatccggcaattctcggcgacgcgatggttggc
acgcaggccatcgaactgtttgccgatgcacaagccatgctcgacaagatcatcgccgag
cgctggctaaccgcacgtgccgtgatcggcttctggccggcacaccgtgttggtgatgac
atcgtcttgtcctcacacgatggcaagaaaacgcatgacctgcatcaccttcgccaacaa
gccgaaaaacccgtcgaacgccccgacttctgtctgtccgacttcatcgcccccaaagaa
gcaaacaaacaggattggctcggcggctttgccgtcaccgcaggcatcggtatcgaacaa
cacgttgcacgctttgaagcagctcacgatgattactccgccattctgctcaaagcgctg
gccgatcgactggctgaagcatttgccgagcgcatgcatgagcgcgtgcgccgtgaattc
tggggatatcagccgaacgaaacgctcgataacgaagcgctgatcgacgaaaaataccgt
ggcattcgcccagcccctggctatccggcctgcccggaccacacggaaaaagccacccta
ttcaagttgctcaacgcacctcacaacacaggcatcgagctgaccgacagtttcgcgatg
tatccgacggcggccgtgtcgggctggtatttctcgcatcccgacagccagtactttgtg
gtggggcgcatcacccgcgaacaggttaacgattacgccaagcgcaaaggttggacacgc
gaagaaaccgaacgctggcttgcacccaatctcgattacgaccccgaataa

KEGG   Dyella sp. M7H15-1: EO087_01600Help
Entry
EO087_01600       CDS       T05846                                 

Definition
(GenBank) 5-methyltetrahydrofolate--homocysteine methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00270  Cysteine and methionine metabolism
dye00450  Selenocompound metabolism
dye00670  One carbon pool by folate
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EO087_01600
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EO087_01600
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EO087_01600
Enzymes [BR:dye01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     EO087_01600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans
Motif
Other DBs
NCBI-ProteinID: QAU22840
UniProt: A0A410UEW7
Position
complement(310209..311294)
Genome map
AA seq 361 aa AA seqDB search
MSTLSWLHPDRVASLEAVLRERILILDGGMGTMLQGHRLDEDGFRGARFVDGRDSDHMHH
HDHPGACDLKGNNDLLTLTQPDIIRDVHEAYLEAGADLVETNTFNSTRISQADYHLEHLA
YELNREGAKLARAACDAFTAKTPAKPRFVIGILGPTSRTASLSPDVNDPGFRNVTFEELV
SNYNEAACGLVDGGADMIMVETIFDTLNAKAALFALSELFRARGRRLPVMISGTITDRSG
RTLSGQTAEAFYYSIKHIRPLSVGLNCALGAADLRPHLQTLANVAECFVSTHPNAGLPNA
FGEYDETPAQMASVIGGFARDGLLNMVGGCCGTTPAHIKAIAEAVRPYAPRAMPSKEKDA
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccctctcctggctccatcctgaccgtgttgcatcgctcgaagccgttttgcgc
gaacgtatcctgatcctcgacggcggcatgggcactatgctgcaaggccatcgcttggac
gaagatggttttcgcggtgcgcgtttcgtggatggacgcgacagcgaccacatgcaccat
cacgatcatcccggtgcttgcgacctgaaaggcaacaacgatctgctgacgctgacccag
ccggacatcatccgcgatgtgcacgaggcatatctggaagccggcgcggacctggtcgaa
accaacaccttcaactctacgcgtatcagtcaagcggattaccacctggaacatctcgcc
tacgaattaaatcgcgaaggtgcaaagctggcgcgcgcagcctgcgatgcctttaccgcc
aaaacaccggccaagccgcgcttcgtcattggcatcctcggccccaccagccgcaccgct
tcactttcaccggacgtcaatgatccaggctttcgtaacgtcaccttcgaagagttggtc
agcaactacaacgaggcggcctgcggactggtcgatggtggcgccgacatgatcatggtc
gagaccatcttcgacacgctcaatgccaaagcggccctgttcgcactgagcgaactgttc
cgtgcacgcggtcgccgcctgccagtgatgatctccggcaccatcaccgatcgctccggc
cgcacactgtctggccagacggccgaagcgttctactactccatcaaacatatccgtccg
ttgtcggtgggcttgaattgcgcgctgggcgcggccgacctgcgcccacatctgcagaca
ctggccaatgtggctgagtgctttgtcagcacacatccgaacgccggtttacccaatgcc
tttggcgaatacgatgaaacaccagcgcaaatggcctcggtgatcggcggttttgcgcgc
gatgggctgctcaatatggtgggcggctgttgcggtacgacgcccgcgcatatcaaagct
attgcggaagcggtgcgcccatacgcgcctcgcgccatgccgtccaaagagaaagatgcg
gtatga

DBGET integrated database retrieval system