KEGG   Dyella sp. M7H15-1: EO087_04465Help
Entry
EO087_04465       CDS       T05846                                 

Definition
(GenBank) 4-hydroxy-tetrahydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00261  Monobactam biosynthesis
dye00300  Lysine biosynthesis
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01230  Biosynthesis of amino acids
Module
dye_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    EO087_04465
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    EO087_04465
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     EO087_04465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_C DapB_N Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: QAU23326
UniProt: A0A410UGJ7
Position
complement(919321..920130)
Genome map
AA seq 269 aa AA seqDB search
MPQPIRLAIHGASGRMGRALLALVREDRRFELVYAVVSAGSEHDGTLVFSELSTSMRYSH
GWEAAPAMDAVVDFSGPAGLVNALAYCTAHGIALVTGTTGIDAALEARLDEATKRIPVLH
AANFSLGVAVLTRLLREAAAALPDWDLEIVEAHHGCKEDAPSGTALAFGHVAAEARGTTL
AKDGVYVREGRPGARRSGSIGFAVVRGGDVVGEHTALLLGHGERVELGHRATDRSIFARG
ALEAAAWLVGHNPGSYSIDDMLQERSSKS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaccgatccgcctcgccatccacggcgcctccggccgaatggggcgcgctttg
ctcgctctggtgcgcgaagatcgccgtttcgaactggtatatgcagtcgtttccgccgga
tcggaacacgatggtacgctagtgttcagcgaactatcgacctcaatgcgttattcgcac
ggctgggaagcggcgcctgccatggatgctgtcgtcgacttcagcggcccagctggtttg
gtcaatgcgttggcgtattgcaccgcgcacggtattgccttggttaccgggacgacaggc
attgatgccgcgctcgaagcaagactggatgaagccacgaaacgcattcccgttttgcac
gctgcgaatttcagccttggcgttgccgtgctgacacgcttgttgcgcgaagccgccgcc
gccttgccggattgggatctggaaatcgtcgaagcgcatcatggctgcaaagaagacgcg
ccttccggcaccgctcttgcgtttggacatgtagccgctgaagcacgtggcaccacactc
gcaaaagacggcgtctacgtccgcgaaggccggcccggtgcgcgccgcagcggaagtatt
ggttttgccgtggtgcgcggtggcgatgtggtgggtgagcacaccgccttgttgcttggc
cacggtgagcgtgtggagttaggccatcgtgcgacggatcgttcgatctttgcgcgtggt
gcacttgaggcagcagcatggttggtcgggcacaatcccggtagttacagcatcgacgac
atgctgcaggaacgtagcagcaaatcgtaa

DBGET integrated database retrieval system